DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment strat and rabif

DIOPT Version :9

Sequence 1:NP_609209.2 Gene:strat / 34142 FlyBaseID:FBgn0032020 Length:122 Species:Drosophila melanogaster
Sequence 2:XP_002939675.1 Gene:rabif / 100145053 XenbaseID:XB-GENE-1007675 Length:118 Species:Xenopus tropicalis


Alignment Length:110 Identity:50/110 - (45%)
Similarity:69/110 - (62%) Gaps:2/110 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DGKNKSNVRCQFCNCLMLKAQEGTYNQEEVDVPLMTQKQDRT-ADSLNSEPLKDFWLVKDMMTFE 76
            ||||...|.||.|.|.:|.|...|..:.|:.:|.|.:|...: :.|.:.|.|.:.|||.||.|||
 Frog     9 DGKNSRAVLCQRCGCRVLSAGVATLAKRELLLPSMRKKSSLSESSSPDCELLAEHWLVHDMFTFE 73

  Fly    77 NIGFSNTVDGRKFLVCADCERGPVGYHDLSTR-HCYLALKRVVHK 120
            |:||:..|...|:|||||||.||:|:|.|..: :.|:||:||.|:
 Frog    74 NVGFTKDVGSIKYLVCADCEVGPIGWHSLEEKSNFYVALERVRHE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stratNP_609209.2 Mss4 34..119 CDD:282300 38/86 (44%)
rabifXP_002939675.1 Mss4 22..117 CDD:367933 41/94 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8508
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37702
Inparanoid 1 1.050 96 1.000 Inparanoid score I4913
OMA 1 1.010 - - QHG49075
OrthoDB 1 1.010 - - D1495679at2759
OrthoFinder 1 1.000 - - FOG0004957
OrthoInspector 1 1.000 - - oto103855
Panther 1 1.100 - - LDO PTHR13276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4040
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.