DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7806 and YKR104W

DIOPT Version :9

Sequence 1:NP_609207.1 Gene:CG7806 / 34140 FlyBaseID:FBgn0032018 Length:1487 Species:Drosophila melanogaster
Sequence 2:NP_013030.1 Gene:YKR104W / 853979 SGDID:S000001812 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:304 Identity:115/304 - (37%)
Similarity:171/304 - (56%) Gaps:43/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1208 AVERIDQYLQLEEEQNASGSAEPPFGWPTQGVLSFREVQLSYREHLAPALRGITFQTEAFERIGI 1272
            :||||.:|..:..|.|  |...||..||..|.:..:.:.|.|..|.:.||..::|:.:|..::||
Yeast     3 SVERIKEYTDIPSESN--GYISPPANWPQTGDVELKNLSLRYSPHSSKALDNVSFKVKAGTKVGI 65

  Fly  1273 VGRTGAGKTSVLAALLRVAPLTHGEIRLDQVNLKTLPLSVLRERIGVITQEPFLFEGTVRENLDP 1337
            ||||||||:|::||:.|::...:|.|.:|..::|.:||..||..|..|.|:|.||:||||.||||
Yeast    66 VGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDP 130

  Fly  1338 RHGFYDSEIW----------------------------HAIKNSAAATLLVQQLGGLDGKVETCG 1374
            ...:.|.:|:                            |.::|         :...|:..|::.|
Yeast   131 FDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRN---------RFIDLNTVVKSGG 186

  Fly  1375 NNLSAGQRQLLCLARALLKNAKVVAIDEGTSNLDDESDLSIQQALRNAFKSCTLLFIAHRLRGLH 1439
            :|||.||||||||||::|....::.|||.|:::|..||..||:.:|...|:.|:|.||||||.:.
Yeast   187 SNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMKNTTILTIAHRLRSVI 251

  Fly  1440 AMDRIIVLDDGRICEEGNPQSLASDSSTIFYGMLLAQDIDPGEF 1483
            ..|:|:|::.||:.|..:|.:|.||.:|||| .|..|.   |||
Yeast   252 DYDKILVMEMGRVKEYDHPYTLISDRNTIFY-RLCRQS---GEF 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7806NP_609207.1 MRP_assoc_pro 6..1472 CDD:188098 110/291 (38%)
ABC_membrane 328..560 CDD:294371
ABCC_MRP_domain1 621..827 CDD:213217
ABC_membrane 948..1192 CDD:279056
ABCC_MRP_domain2 1238..1458 CDD:213211 90/247 (36%)
YKR104WNP_013030.1 ABCC_NFT1 27..270 CDD:213269 92/251 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.