DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7806 and NAP5

DIOPT Version :9

Sequence 1:NP_609207.1 Gene:CG7806 / 34140 FlyBaseID:FBgn0032018 Length:1487 Species:Drosophila melanogaster
Sequence 2:NP_177289.1 Gene:NAP5 / 843474 AraportID:AT1G71330 Length:324 Species:Arabidopsis thaliana


Alignment Length:343 Identity:106/343 - (30%)
Similarity:155/343 - (45%) Gaps:86/343 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   718 DEQWYKTVLHACALEEDLQILG-GDLVGVGENGRTLSGGQRARVALARAVYQDKKVYLLDDVLSS 781
            |.:.|..|:.||:|.:||:||. ||...:||.|..|||||:.|:.:|||:|||..:||.||..|:
plant     2 DRERYDKVIEACSLSKDLEILSFGDQTVIGERGINLSGGQKQRIHIARALYQDADIYLFDDPFSA 66

  Fly   782 LDAHVARHIIKHCILRLLKHKTRIVVTRNIQLFFHANQILQVKDG-------------------Q 827
            :|||...|:.|..:..||..|:.|.||..::....|:..|.:|||                   :
plant    67 VDAHTGSHLFKEALRGLLCSKSVIYVTHQVEFLPSADLTLVMKDGRISQAGKYNDILISGTDFRE 131

  Fly   828 LLPSEYMTQSIELSLD------EDADDEQEPTVR--------RRSVELSNQYDKKSLDS------ 872
            |:.:...:.::..|.|      ..|.||:...||        :.|.:|.|  ||  |||      
plant   132 LIGAHQESLAVVGSADASSVSENSALDEENGVVRDDIGFDGKQESQDLKN--DK--LDSGEPQRQ 192

  Fly   873 LLLEELREYGHLSGNVFTCYWKAVTSPLAF------TVLLSVVLMQLTRNLSDAWLAYWVTETTL 931
            .:.||.|..|.::.:|   |||.:|  ||:      .:||..:|.||.:..|:.|:| |.|..:.
plant   193 FVQEEERAKGSVALDV---YWKYIT--LAYGGALVPFILLGQILFQLLQIGSNYWMA-WATPISE 251

  Fly   932 D---PHKNDTSLDHILMRPTVGNETESGHTTKFYLSIFTAIAVSNSLVTLARAFLFAYAGIKAA- 992
            |   |.|..|                       .:.::.|:|..:||..|.||.|...||.|.| 
plant   252 DVQAPVKLST-----------------------LMVVYVALAFGSSLCILVRATLLVTAGYKTAT 293

  Fly   993 -IF--MHEKLLKKVMFAK 1007
             :|  ||..:.:..|..|
plant   294 ELFHKMHHCIFRSPMSFK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7806NP_609207.1 MRP_assoc_pro 6..1472 CDD:188098 106/343 (31%)
ABC_membrane 328..560 CDD:294371
ABCC_MRP_domain1 621..827 CDD:213217 48/128 (38%)
ABC_membrane 948..1192 CDD:279056 17/64 (27%)
ABCC_MRP_domain2 1238..1458 CDD:213211
NAP5NP_177289.1 P-loop_NTPase <1..112 CDD:304359 47/109 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138195at2759
OrthoFinder 1 1.000 - - FOG0000087
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.