DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7806 and LOC4397657

DIOPT Version :10

Sequence 1:NP_609207.1 Gene:CG7806 / 34140 FlyBaseID:FBgn0032018 Length:1487 Species:Drosophila melanogaster
Sequence 2:XP_061510127.1 Gene:LOC4397657 / 4397657 VectorBaseID:AGAMI1_001984 Length:1504 Species:Anopheles gambiae


Alignment Length:93 Identity:22/93 - (23%)
Similarity:34/93 - (36%) Gaps:5/93 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 EN--FSLQQFGLNSGRVSIASGNSQLPAQLFTTIGIYKGERVAIKKVAKKKVYITSTLLWEIKQA 576
            ||  |:..:....|..:|..||:...||...::.......:...|..:||....|||........
Mosquito   530 ENPFFASTEVPAGSSSISTPSGSQSTPASASSSAASRCRMKGFFKVFSKKAPASTSTPASSTPGT 594

  Fly   577 RDVSHENTVRFVGACIDLPRPTILILTE 604
            ...:....:|..|..|..|   :|.:||
Mosquito   595 SRAARPECLRSSGIIISAP---VLAITE 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7806NP_609207.1 MRP_assoc_pro 6..1472 CDD:188098 22/93 (24%)
LOC4397657XP_061510127.1 None

Return to query results.
Submit another query.