DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ostgamma and OST6

DIOPT Version :9

Sequence 1:NP_609204.2 Gene:Ostgamma / 34137 FlyBaseID:FBgn0032015 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_013693.1 Gene:OST6 / 854989 SGDID:S000004481 Length:332 Species:Saccharomyces cerevisiae


Alignment Length:340 Identity:67/340 - (19%)
Similarity:137/340 - (40%) Gaps:34/340 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SGLLVVALFAIYAAAQSKSKTGLSLSEKVQNLVDMNAKKPLLRFNGPKFREYVKSAPRNYSM--I 72
            |..:::.|..|:...|..:.|.   |..:.:::.:.....::......:....:..|..:::  |
Yeast     5 STYIIIWLAIIFHKFQKSTATA---SHNIDDILQLKDDTGVITVTADNYPLLSRGVPGYFNILYI 66

  Fly    73 VMLTALAPSRQCQICRHAHDEFAIVANSYRFSSTYSNKLFFAMVDFDDGSEVFQLLRLNTAPVFM 137
            .|....:....||:|......:..||:..|..:..|..|||. ||.::..::.:.|:|...|..:
Yeast    67 TMRGTNSNGMSCQLCHDFEKTYHAVADVIRSQAPQSLNLFFT-VDVNEVPQLVKDLKLQNVPHLV 130

  Fly   138 HFPAKGKPKGAD----TMDIHRVGFAADS------IAKFVAERTDITIRIFRPPNYSGTVAMITL 192
            .:|.....|.:.    |...::.....::      ...|:|:..:|:|.:  |..::....:...
Yeast   131 VYPPAESNKQSQFEWKTSPFYQYSLVPENAENTLQFGDFLAKILNISITV--PQAFNVQEFVYYF 193

  Fly   193 VALVGSFLYIRRNNLEFLYNKNLWGAIAVFFCFAM----ISGQMWNHIRGPPLVHKSQNGGVAYI 253
            ||.:..|::|::..|..:.||  |...::.....:    |:|..:..:...|.:.:.....:.|.
Yeast   194 VACMVVFIFIKKVILPKVTNK--WKLFSMILSLGILLPSITGYKFVEMNAIPFIARDAKNRIMYF 256

  Fly   254 HGSSQGQLVVETYIVMFLNAMIVLGMILLIESGTPKAHNKNRIMAMTGLV------LLTVFFSFL 312
            .|.|..|..:|.:.|..:..::....:|||.  .||....:.  .|.||:      :|..|||:.
Yeast   257 SGGSGWQFGIEIFSVSLMYIVMSALSVLLIY--VPKISCVSE--KMRGLLSSFLACVLFYFFSYF 317

  Fly   313 LSVFRSKAQGYPYSF 327
            :|.:..|..|||..|
Yeast   318 ISCYLIKNPGYPIVF 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OstgammaNP_609204.2 OST3_OST6 164..312 CDD:282594 34/157 (22%)
OST6NP_013693.1 OST3_OST6 37..329 CDD:398430 58/300 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345467
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12692
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.