DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ostgamma and AT1G11560

DIOPT Version :9

Sequence 1:NP_609204.2 Gene:Ostgamma / 34137 FlyBaseID:FBgn0032015 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_172622.1 Gene:AT1G11560 / 837699 AraportID:AT1G11560 Length:343 Species:Arabidopsis thaliana


Alignment Length:344 Identity:83/344 - (24%)
Similarity:147/344 - (42%) Gaps:50/344 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLVVALFAIYAAAQSKSKTGLSLSEKVQNLVDM--NAKKPLLRFNGPKFREYVK--SAPRNYSMI 72
            :|:|.||.:   |..||.:.|.     ..||.:  .|:..::.||.....:::.  |.||.||:|
plant    13 ILIVFLFTL---ANPKSDSDLK-----NELVSLRSTAESGVISFNNDDVSKFITSVSTPRPYSLI 69

  Fly    73 VMLTALAPSRQCQICRHAHD-----------EFAIVANSY---RFSSTYSNKLFFAMVDFDDGSE 123
            :...|:          |.|.           ||.:|:.::   ..:.:...||||..::......
plant    70 IFFDAV----------HLHGNSQLRLPEFRREFRLVSATFITNNNNESNGTKLFFCEIESTHSEA 124

  Fly   124 VFQLLRLNTAP-VFMHFPAKGKPKGADTMDIHRVGFAADSIAKFVAERTDITI-RIFRPPNYSGT 186
            .|:...:.:.| :.:..|.......:|.||.......|:|:|:||..:|.:|: .|.|||..|.|
plant   125 SFRRFAVESLPHISLVSPTTENLTESDQMDGGDFTGLAESMAEFVERQTKLTVCSIQRPPLISKT 189

  Fly   187 -VAMITLVALVGSFLYIRR--NNLEFLYNKNLWGAIAVFFCFAMISGQMWNHIRGPPLVHKSQNG 248
             :.:|..:.::.:.:.|::  .....|::..:|...|||..|..:||.|.|.||..|:..|....
plant   190 QIGIIVAIIIISTPILIKKILKGETLLHDHRIWLVGAVFVYFFSVSGTMHNIIREMPMYIKDYED 254

  Fly   249 GVAYIH--GSSQGQLVVETYIVMFLNAMIVLGMILLIESGTPKAHNKNRIMAMTGLVLLTVFFSF 311
            ...::.  ..|:.||..|.:.|.||  ..|:|::|...:.......|.....|..|:.|::.|..
plant   255 SSKFVFFIEESEMQLGAEGFFVGFL--YTVVGLLLAFVTNVVVRVKKLDEQRMAMLLALSISFWA 317

  Fly   312 LLSV-----FRSKAQGYPY 325
            :..|     :::..:.|||
plant   318 VRKVVYLDNWKTGYEIYPY 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OstgammaNP_609204.2 OST3_OST6 164..312 CDD:282594 42/153 (27%)
AT1G11560NP_172622.1 OST3_OST6 166..319 CDD:282594 42/154 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3364
eggNOG 1 0.900 - - E1_KOG2603
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I2432
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1460433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3019
orthoMCL 1 0.900 - - OOG6_101708
Panther 1 1.100 - - O PTHR12692
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.