DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ostgamma and Tusc3

DIOPT Version :9

Sequence 1:NP_609204.2 Gene:Ostgamma / 34137 FlyBaseID:FBgn0032015 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001344235.1 Gene:Tusc3 / 80286 MGIID:1933134 Length:348 Species:Mus musculus


Alignment Length:319 Identity:183/319 - (57%)
Similarity:243/319 - (76%) Gaps:3/319 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLVVALFAIYAAAQSKSKTGLSLSEKVQNLVDMNAKKPLLRFNGPKFREYVKSAPRNYSMIVMLT 76
            ||::.|..|......|.|..| |:|||:.|::.::::.:.|.||.|||::||:.|||||||||.|
Mouse    28 LLLLLLLCIQLGGGQKKKENL-LAEKVEQLMEWSSRRSIFRMNGDKFRKFVKAPPRNYSMIVMFT 91

  Fly    77 ALAPSRQCQICRHAHDEFAIVANSYRFSSTYSNKLFFAMVDFDDGSEVFQLLRLNTAPVFMHFPA 141
            ||.|.|||.:||.|::|:.|:|||:|:||.:.|||||.|||:|:|::|||.|.:|:||.|||||:
Mouse    92 ALQPQRQCSVCRQANEEYQILANSWRYSSAFCNKLFFGMVDYDEGTDVFQQLNMNSAPTFMHFPS 156

  Fly   142 KGKPKGADTMDIHRVGFAADSIAKFVAERTDITIRIFRPPNYSGTVAMITLVALVGSFLYIRRNN 206
            ||:||.|||.|:.|:||||:.:||::|:|||:.||:|||||||||:|:..||:|||..||:||||
Mouse   157 KGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNN 221

  Fly   207 LEFLYNKNLWGAIAVFFCFAMISGQMWNHIRGPPLVHKS-QNGGVAYIHGSSQGQLVVETYIVMF 270
            |||:|||..|..:::...|||.||||||||||||..||: .||.|:|||||||.|.|.|::|::.
Mouse   222 LEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILV 286

  Fly   271 LNAMIVLGMILLIESGTPKAH-NKNRIMAMTGLVLLTVFFSFLLSVFRSKAQGYPYSFL 328
            |||.|.:||:||.|:.|.|.. .|.||:.:.||.|:..|||||||:||||..|||||.|
Mouse   287 LNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSDL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OstgammaNP_609204.2 OST3_OST6 164..312 CDD:282594 87/149 (58%)
Tusc3NP_001344235.1 OST3_OST6 54..342 CDD:398430 168/287 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847005
Domainoid 1 1.000 370 1.000 Domainoid score I903
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6937
Inparanoid 1 1.050 391 1.000 Inparanoid score I1970
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52911
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002554
OrthoInspector 1 1.000 - - otm43872
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12692
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1886
SonicParanoid 1 1.000 - - X2260
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.030

Return to query results.
Submit another query.