DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ostgamma and tusc3

DIOPT Version :9

Sequence 1:NP_609204.2 Gene:Ostgamma / 34137 FlyBaseID:FBgn0032015 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_002934712.1 Gene:tusc3 / 100487046 XenbaseID:XB-GENE-852905 Length:342 Species:Xenopus tropicalis


Alignment Length:325 Identity:186/325 - (57%)
Similarity:250/325 - (76%) Gaps:4/325 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLSGLLVVALFAIYAAAQSKSKTGLSLSEKVQNLVDMNAKKPLLRFNGPKFREYVKSAPRNYSMI 72
            ::..||:::| .:.:....|.|..| |||||:.:::.::::.::|.||.|||.:||:.|||||:|
 Frog    20 IVPSLLILSL-CLQSGGGQKKKENL-LSEKVEQMMEWSSRRSVIRMNGDKFRRFVKAPPRNYSVI 82

  Fly    73 VMLTALAPSRQCQICRHAHDEFAIVANSYRFSSTYSNKLFFAMVDFDDGSEVFQLLRLNTAPVFM 137
            ||.|||.|.|||.:||.|::|:.::|||:|:||.:||||||.:||:|:|::|||.|.:|:||.||
 Frog    83 VMFTALQPQRQCSVCRQANEEYQVLANSWRYSSAFSNKLFFTIVDYDEGADVFQQLNMNSAPTFM 147

  Fly   138 HFPAKGKPKGADTMDIHRVGFAADSIAKFVAERTDITIRIFRPPNYSGTVAMITLVALVGSFLYI 202
            |||||||||.|||.|:.|:||||:.:||::|:|||:.||:|||||||||:|:..||:|||..||:
 Frog   148 HFPAKGKPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYL 212

  Fly   203 RRNNLEFLYNKNLWGAIAVFFCFAMISGQMWNHIRGPPLVHKS-QNGGVAYIHGSSQGQLVVETY 266
            |||||||:|||..|...|:...|||.||||||||||||..||: |||.|:|||||||.|.|.|::
 Frog   213 RRNNLEFIYNKTGWAMAALCVVFAMTSGQMWNHIRGPPYAHKNPQNGQVSYIHGSSQAQFVAESH 277

  Fly   267 IVMFLNAMIVLGMILLIESGTPKAH-NKNRIMAMTGLVLLTVFFSFLLSVFRSKAQGYPYSFLFK 330
            |::.|||.|.:||:||.|:.|.|.. .|.||:.:.||.|:..|||||||:||||..|||||||.|
 Frog   278 IILLLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSFLIK 342

  Fly   331  330
             Frog   343  342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OstgammaNP_609204.2 OST3_OST6 164..312 CDD:282594 89/149 (60%)
tusc3XP_002934712.1 OST3_OST6 49..337 CDD:368099 169/287 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 364 1.000 Domainoid score I935
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6937
Inparanoid 1 1.050 384 1.000 Inparanoid score I1990
OMA 1 1.010 - - QHG52911
OrthoDB 1 1.010 - - D1460433at2759
OrthoFinder 1 1.000 - - FOG0002554
OrthoInspector 1 1.000 - - otm49047
Panther 1 1.100 - - LDO PTHR12692
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2260
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.