DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7840 and Srd5a2

DIOPT Version :9

Sequence 1:NP_609203.1 Gene:CG7840 / 34136 FlyBaseID:FBgn0032014 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_444418.1 Gene:Srd5a2 / 94224 MGIID:2150380 Length:254 Species:Mus musculus


Alignment Length:326 Identity:76/326 - (23%)
Similarity:117/326 - (35%) Gaps:120/326 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ATIVFFGGLMTFVEKYLPNSIRQSFRYGKHSFKGETD-PL----VAWL--EVPKSWFKHFYTFAL 90
            ||:...|.|:....|  |.|      |||||....:. ||    :||.  |:|            
Mouse    15 ATLATMGTLILCFGK--PAS------YGKHSESVSSGVPLLPARIAWFLQELP------------ 59

  Fly    91 FWSWLAFYVLVSTVREQKEA----PEYVLQFLDIMGGGRSHRK---------------VEIDSTT 136
                 :|.|.|..:..|..:    |..||  |.:......||.               :.:.:|.
Mouse    60 -----SFVVSVGMLAWQPRSLFGPPGNVL--LGLFSAHYFHRTFIYSLLTRGRPLSAVIFLKATA 117

  Fly   137 ACVGAFMLTLQCTRRFYETNFVQIFSKKSKINLSHYAVGYVHYFGAVIALLSNTSGFVRGSKPME 201
            .|:|..:|.                        ::|.|....|                   |.|
Mouse   118 FCIGNGLLQ------------------------AYYLVYCAEY-------------------PEE 139

  Fly   202 FSLDKLTSQQILYLGVFF--LAWQQQYASNMILVNLRKDPRTGSVKTEKHLLPKGGLFNLLSSPH 264
            :..|...|     :||||  |.......|:.:|..|||   .|.|   .:.:|:||||..:|..:
Mouse   140 WYTDMRFS-----VGVFFFILGMGINIHSDCMLRQLRK---PGEV---IYRIPQGGLFTYVSGAN 193

  Fly   265 MFLEVV--MYFCIADLYMPV---RIWRLIFLWVASNQTINALLTHKWYQETFREYPKNRRAIIPF 324
            ...|::  |.:.:|...:|.   ..:.|.||      .:.|...|::|.:.|::|||:|:|:|||
Mouse   194 FLGEIIEWMGYALATWSVPAFAFAFFTLCFL------GMQAFYHHRFYLKMFKDYPKSRKALIPF 252

  Fly   325 L 325
            :
Mouse   253 I 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7840NP_609203.1 PEMT 77..325 CDD:304400 58/273 (21%)
Srd5a2NP_444418.1 Steroid_dh 105..254 CDD:251363 48/209 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.