DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7840 and AT1G72590

DIOPT Version :9

Sequence 1:NP_609203.1 Gene:CG7840 / 34136 FlyBaseID:FBgn0032014 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_177403.1 Gene:AT1G72590 / 843591 AraportID:AT1G72590 Length:320 Species:Arabidopsis thaliana


Alignment Length:322 Identity:86/322 - (26%)
Similarity:139/322 - (43%) Gaps:54/322 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VFFGGLMTFVEKYLPNSIRQSFRYGKHSFKGE---TDPLVAWLEVPKSWFKHFYTFALFWSWLAF 97
            |:...::..|...:|:|...|||....||.|.   ..|......||:.:|.|||...:.|:.|  
plant    16 VWIVSILPLVIASIPSSKLNSFRELVLSFAGRGKILHPSSQKFTVPQKFFGHFYVVGVVWTTL-- 78

  Fly    98 YVLVSTVREQKEAPEYVLQFLDIMGGG-------RSHRKVEIDSTTACVGAFMLTLQCTRRFYET 155
             :|.:|           ..:...|.||       .:|.:.......|.....::.:...||..|:
plant    79 -LLAAT-----------WMYACKMAGGSHVFSFHMTHVEHRFKVGRAVFLLLLMEIHVLRRVIES 131

  Fly   156 NFVQIFSKKSKINLSHYAVGYVHYFGAVIALLSN----TSGFVRGSKPMEF-------------- 202
            .:|..:|..:::::..|.....:|..|.::|.||    .:.|| ||:..||              
plant   132 FYVFKYSTSARMHILAYVGALFYYVAAPLSLCSNIAPEVARFV-GSQVAEFIASGKSHSHDFNLL 195

  Fly   203 ----SLDKLTSQQILYLGVFFLAWQQQYASNMILVNLRKDPRTGSVKTEKHLLPKGGLFNLLSSP 263
                .|.||.|.|.:...:|...|..|...:.||.:||:.|.    :.:::::|.|..|.::|.|
plant   196 LSISPLMKLGSLQWIGGAIFLWGWIHQRRCHAILGSLREYPS----QAKEYIIPYGDWFEMVSCP 256

  Fly   264 HMFLEVVMY--FCIADLYMPVRIWRLIFLWVASNQTINALLTHKWYQETFREYPKNRRAIIP 323
            |...|:|:|  ..|:.....:.|| |:|.:||:|.|..|..||:||.:.|..||.:|.||.|
plant   257 HFLAEIVLYLGLLISSGGTDISIW-LLFGFVAANLTYAAGETHRWYLQKFENYPASRHAIFP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7840NP_609203.1 PEMT 77..325 CDD:304400 75/278 (27%)
AT1G72590NP_177403.1 PLN03164 20..320 CDD:215610 85/318 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 75 1.000 Domainoid score I3198
eggNOG 1 0.900 - - E1_KOG1640
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I2159
OMA 1 1.010 - - QHG54685
OrthoDB 1 1.010 - - D1574389at2759
OrthoFinder 1 1.000 - - FOG0002741
OrthoInspector 1 1.000 - - otm3429
orthoMCL 1 0.900 - - OOG6_103960
Panther 1 1.100 - - O PTHR14624
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.