DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7840 and AT5G16010

DIOPT Version :9

Sequence 1:NP_609203.1 Gene:CG7840 / 34136 FlyBaseID:FBgn0032014 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_197105.1 Gene:AT5G16010 / 831458 AraportID:AT5G16010 Length:268 Species:Arabidopsis thaliana


Alignment Length:199 Identity:44/199 - (22%)
Similarity:81/199 - (40%) Gaps:49/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 LTLQCTRRFYETNFVQIFSKKSKINLSHYAVGYVHYFGAVIALLSN--TSGFVRGSKPMEFSLDK 206
            |.|...:|.:|..|:..:|....|: |...:...::....:.|.|.  |.|....|..|     |
plant   101 LALHFFKRVFEVLFIHKYSGGMAID-SALTISSSYFSSTALMLYSQNLTLGLTEPSFDM-----K 159

  Fly   207 LTSQQILYLGVFFLAWQQQYASNMILVNLRKDPRTGSVKTEKHLLPKGGLFNLLSSPHMFLEVVM 271
            |....:..:|:....:.     :::|..|||:.     ..:::.:||||||:::..||...|:::
plant   160 LAGVVMFVVGIVGNLYH-----HVLLAKLRKED-----GKKEYKIPKGGLFDIIICPHYLFEILV 214

  Fly   272 YFCIADLYMPVRIWRLIFLWVASNQTI---------------NALLTHKWYQETFREYPKNRRAI 321
            :            |....:    :|||               .:..|..||...|.::||:.:|:
plant   215 F------------WSFFLI----SQTIYSFSFAMGTMLYLIGRSYATRTWYLSKFDDFPKHIKAL 263

  Fly   322 IPFL 325
            |||:
plant   264 IPFV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7840NP_609203.1 PEMT 77..325 CDD:304400 43/197 (22%)
AT5G16010NP_197105.1 PLN02560 <68..231 CDD:178174 34/161 (21%)
PEMT <157..268 CDD:304400 31/142 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.