powered by:
Protein Alignment CG7840 and AT3G43840
DIOPT Version :9
Sequence 1: | NP_609203.1 |
Gene: | CG7840 / 34136 |
FlyBaseID: | FBgn0032014 |
Length: | 326 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001319677.1 |
Gene: | AT3G43840 / 823497 |
AraportID: | AT3G43840 |
Length: | 84 |
Species: | Arabidopsis thaliana |
Alignment Length: | 60 |
Identity: | 25/60 - (41%) |
Similarity: | 32/60 - (53%) |
Gaps: | 3/60 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 266 FLEVVMYFCIADLYMPVRIWRLIFLWVASNQTINALLTHKWYQETFREYPKNRRAIIPFL 325
||....|.......:| || |:|.:||:|.|..|..||:||...|..||.||.||.|::
plant 27 FLSAFKYEVKKSANLP--IW-LLFGFVAANLTYAAGETHRWYLAKFENYPANRHAIFPYV 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7840 | NP_609203.1 |
PEMT |
77..325 |
CDD:304400 |
25/58 (43%) |
AT3G43840 | NP_001319677.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1640 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1574389at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002741 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.