DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7840 and AT3G43840

DIOPT Version :9

Sequence 1:NP_609203.1 Gene:CG7840 / 34136 FlyBaseID:FBgn0032014 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001319677.1 Gene:AT3G43840 / 823497 AraportID:AT3G43840 Length:84 Species:Arabidopsis thaliana


Alignment Length:60 Identity:25/60 - (41%)
Similarity:32/60 - (53%) Gaps:3/60 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 FLEVVMYFCIADLYMPVRIWRLIFLWVASNQTINALLTHKWYQETFREYPKNRRAIIPFL 325
            ||....|.......:|  || |:|.:||:|.|..|..||:||...|..||.||.||.|::
plant    27 FLSAFKYEVKKSANLP--IW-LLFGFVAANLTYAAGETHRWYLAKFENYPANRHAIFPYV 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7840NP_609203.1 PEMT 77..325 CDD:304400 25/58 (43%)
AT3G43840NP_001319677.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1640
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574389at2759
OrthoFinder 1 1.000 - - FOG0002741
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.