DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7840 and DET2

DIOPT Version :9

Sequence 1:NP_609203.1 Gene:CG7840 / 34136 FlyBaseID:FBgn0032014 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_181340.1 Gene:DET2 / 818383 AraportID:AT2G38050 Length:262 Species:Arabidopsis thaliana


Alignment Length:344 Identity:80/344 - (23%)
Similarity:127/344 - (36%) Gaps:113/344 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LENLLDRYKINLLQMMFGTFIATIVFFGGLMTFVEKYLPNSIRQSFRYGKHSFKG---ETDPLVA 73
            :|.:.|:       ..|...:.|::|.|.....:.|:|      ...||||:..|   ...|.:|
plant     1 MEEIADK-------TFFRYCLLTLIFAGPPTAVLLKFL------QAPYGKHNRTGWGPTVSPPIA 52

  Fly    74 W--LEVPKSWF--------KHFY---TFALFWSWLAFYVLVSTVREQKEAPEYVLQ-FLDIMGGG 124
            |  :|.|..|.        :|..   :..||..:|..|...:.:        |.|: |......|
plant    53 WFVMESPTLWLTLLLFPFGRHALNPKSLLLFSPYLIHYFHRTII--------YPLRLFRSSFPAG 109

  Fly   125 RSHRKVEIDSTTACVGAFMLTLQCTRRFYETNFVQIFSKKSKINLSHYAVGYV--HYF------G 181
            ::...:.|       .|...|......:.:..:|           |||...|.  ::|      |
plant   110 KNGFPITI-------AALAFTFNLLNGYIQARWV-----------SHYKDDYEDGNWFWWRFVIG 156

  Fly   182 AVIALLSNTSGFVRGSKPMEFSLDKLTSQQILYLGVFFLAWQQQYASNMILVNLRKDPRTGSVKT 246
            .|:        |:.|                :|:.:         .|:..||.|:|:.|.|    
plant   157 MVV--------FITG----------------MYINI---------TSDRTLVRLKKENRGG---- 184

  Fly   247 EKHLLPKGGLFNLLSSPHMFLEVVMYFCIADLYMPVRIWRL----IFLWVASNQTINALLTHKWY 307
              :::|:||.|.|:|.|:.|.|.:.:     |...|..|..    .||:..||....|..:||||
plant   185 --YVIPRGGWFELVSCPNYFGEAIEW-----LGWAVMTWSWAGIGFFLYTCSNLFPRARASHKWY 242

  Fly   308 QETFR-EYPKNRRAIIPFL 325
            ...|: ||||.|:|:|||:
plant   243 IAKFKEEYPKTRKAVIPFV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7840NP_609203.1 PEMT 77..325 CDD:304400 62/272 (23%)
DET2NP_181340.1 PLN02392 2..262 CDD:178015 80/343 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.