DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7840 and srd5a3

DIOPT Version :9

Sequence 1:NP_609203.1 Gene:CG7840 / 34136 FlyBaseID:FBgn0032014 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_012820873.2 Gene:srd5a3 / 779994 XenbaseID:XB-GENE-985511 Length:318 Species:Xenopus tropicalis


Alignment Length:337 Identity:98/337 - (29%)
Similarity:155/337 - (45%) Gaps:41/337 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PPENGILEVLENLLDRYKINLLQMMFGTFIATIVFF------GGLMTFVEKYLPNSIRQSFRYGK 61
            ||...:|.::..|||           .||:.|:::.      .|     ...|.:..:...||||
 Frog     8 PPGMTLLALVWLLLD-----------ATFLITLLWHLLQGCKSG-----HSLLCSVFQDLIRYGK 56

  Fly    62 HSFKGETDPLVAWLEVPKSWFKHFYTFALFWSWLAFYVLVSTVREQKEAPEYVLQFLDIMGGGRS 126
            .....:....:.|.::||..|.|||..:|.|:....::|:..:.:....||::...|..:..| |
 Frog    57 TKTGLQRPAWLQWFDIPKRCFWHFYCVSLIWNGCLLWILLRLLLQSVPVPEWLQLVLHFLHAG-S 120

  Fly   127 HRKVEIDSTTACVGAFMLTLQCTRRFYETNFVQIFSKKSKINLSHYAVGYVHYFGAVIALLSNTS 191
            ..::.....:..:...:|.|...||..|..||.:|| ...|:|..|..|..:||...|.:|:.. 
 Frog   121 EPQILDRELSVILALALLWLHSLRRLLECLFVSVFS-NGVIHLVQYCFGLGYYFLIGITVLTYC- 183

  Fly   192 GFVRGSKPME---FSLDKLTSQ----QILYLGVFFLAWQQQYASNMILVNLRKDPRTGSVKTEKH 249
                   |::   .|.|.|.:|    .||.|.::..|...||..:.||..|||. .:|:|....|
 Frog   184 -------PLDRRTVSTDNLLTQCHWYHILGLALYIWASLHQYRCHCILAGLRKS-ASGNVINLNH 240

  Fly   250 LLPKGGLFNLLSSPHMFLEVVMYFCIADLY-MPVRIWRLIFLWVASNQTINALLTHKWYQETFRE 313
            .:|.|..|..:|.||.|.|:::|..||.:: :...||.|:.|:|..||.:.|||.|::|.|.|..
 Frog   241 SVPCGDWFERVSCPHYFAELLIYVSIAVVFGLLNTIWWLVVLFVLLNQALAALLCHEFYHEKFDT 305

  Fly   314 YPKNRRAIIPFL 325
            ||.:|:|.|||:
 Frog   306 YPIHRKAFIPFI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7840NP_609203.1 PEMT 77..325 CDD:304400 81/255 (32%)
srd5a3XP_012820873.2 PEMT 70..318 CDD:419701 82/259 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8549
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41385
Inparanoid 1 1.050 123 1.000 Inparanoid score I4581
OMA 1 1.010 - - QHG54685
OrthoDB 1 1.010 - - D1574389at2759
OrthoFinder 1 1.000 - - FOG0002741
OrthoInspector 1 1.000 - - otm48459
Panther 1 1.100 - - LDO PTHR14624
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2089
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.