DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7840 and SRD5A2

DIOPT Version :9

Sequence 1:NP_609203.1 Gene:CG7840 / 34136 FlyBaseID:FBgn0032014 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_000339.2 Gene:SRD5A2 / 6716 HGNCID:11285 Length:254 Species:Homo sapiens


Alignment Length:320 Identity:75/320 - (23%)
Similarity:118/320 - (36%) Gaps:108/320 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ATIVFFGGLMTFVEKYLPNSIRQSFRYGKH--SFKGETDPLVAWLEVPKSWF-KHFYTFALFWSW 94
            ||:|..|.|..:|.|  |:.      ||||  |.|    |....|....:|| :...:||:    
Human    15 ATLVALGALALYVAK--PSG------YGKHTESLK----PAATRLPARAAWFLQELPSFAV---- 63

  Fly    95 LAFYVLVSTVREQKEAPEYVL--QFLDIMGGGRSHRKVEIDSTTACVGAFMLTLQCTRRFYETNF 157
                            |..:|  |.|.:.|.               .|..:|.|.|...|:.| |
Human    64 ----------------PAGILARQPLSLFGP---------------PGTVLLGLFCLHYFHRT-F 96

  Fly   158 VQIFSKKSKINLSHYAVGYVHYFGAVIALLSNTSGFVRGSKPMEFSLDKLTSQQILY-------- 214
            |.....:.:            .:.|::.|  ..:.|..|:       ..|....::|        
Human    97 VYSLLNRGR------------PYPAILIL--RGTAFCTGN-------GVLQGYYLIYCAEYPDGW 140

  Fly   215 -------LGV--FFLAWQQQYASNMILVNLRKDPRTGSVKTEKHLLPKGGLFNLLSSPHMFLEVV 270
                   |||  |.|.......|:.||..|||   .|.:   .:.:|:||||..:|..:...|::
Human   141 YTDIRFSLGVFLFILGMGINIHSDYILRQLRK---PGEI---SYRIPQGGLFTYVSGANFLGEII 199

  Fly   271 MY--FCIADLYMPV---RIWRLIFLWVASNQTINALLTHKWYQETFREYPKNRRAIIPFL 325
            .:  :.:|...:|.   ..:.|.||      .:.|...|::|.:.|.:|||:|:|:|||:
Human   200 EWIGYALATWSLPALAFAFFSLCFL------GLRAFHHHRFYLKMFEDYPKSRKALIPFI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7840NP_609203.1 PEMT 77..325 CDD:304400 58/272 (21%)
SRD5A2NP_000339.2 Steroid_dh 105..254 CDD:251363 42/182 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.