DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7840 and srd5a2b

DIOPT Version :9

Sequence 1:NP_609203.1 Gene:CG7840 / 34136 FlyBaseID:FBgn0032014 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_005157051.1 Gene:srd5a2b / 550388 ZFINID:ZDB-GENE-050417-182 Length:252 Species:Danio rerio


Alignment Length:306 Identity:65/306 - (21%)
Similarity:119/306 - (38%) Gaps:85/306 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VFFGGLMTFVEKYLPNSIRQSFRYGKHSFKGETDPLVAWLEVPK--SWFKHFYTFALFWSWLAFY 98
            :..||:|.|:     ..::....||::     .|...:.:.||.  :||                
Zfish    15 MILGGVMHFI-----CLMKSHAAYGRY-----VDTSGSSMMVPARLAWF---------------- 53

  Fly    99 VLVSTVREQKEAPEYVLQFLDIMGGGRSHRKVEIDSTTACVGA---FMLTLQCTRRFYETNFVQI 160
                    .:|.|..::..|.:|....:|            |.   .||...|...|..:....:
Zfish    54 --------LQEIPALLVPLLLMMTTDGNH------------GTGKHLMLWTFCLHYFQRSCIYSL 98

  Fly   161 FSKKSKINLSHYAVGYVHYFGAVI--ALLSNTSGFVRGSKPMEFSLDKLT--SQQILYLG--VFF 219
            .:|           |..:.|..::  .::.:.:||::....:..:....|  |...|..|  :||
Zfish    99 LTK-----------GRPYPFNIMLTGVVVCSINGFLQAHYLLHCATFHSTWFSDACLLTGLIIFF 152

  Fly   220 LAWQQQYASNMILVNLRKDPRTGSVKTEKHLLPKGGLFNLLSSPHMFLEVVMY--FCIADLYMPV 282
            |.......|:.||.||| :|...|.|     :|:||:|..:|..:.|.|:|.:  :.:|...:|.
Zfish   153 LGMGINIHSDHILRNLR-NPGEISYK-----IPRGGMFEYVSGANFFGEIVEWLGYAVATWSLPT 211

  Fly   283 ---RIWRLIFLWVASNQTINALLTHKWYQETFREYPKNRRAIIPFL 325
               ..:.:.|:..      .|...||:|.|.|:::|::||::|||:
Zfish   212 FAFAFFTICFIGP------RAYHHHKFYNEKFKDFPRSRRSLIPFI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7840NP_609203.1 PEMT 77..325 CDD:304400 57/263 (22%)
srd5a2bXP_005157051.1 Steroid_dh 103..252 CDD:251363 42/161 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.