DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7840 and srd5a1

DIOPT Version :9

Sequence 1:NP_609203.1 Gene:CG7840 / 34136 FlyBaseID:FBgn0032014 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001006841.1 Gene:srd5a1 / 448586 XenbaseID:XB-GENE-1000046 Length:257 Species:Xenopus tropicalis


Alignment Length:316 Identity:83/316 - (26%)
Similarity:127/316 - (40%) Gaps:84/316 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 INLLQMMFGTFIATIVFFGGLMTFVE-KYLPNSIRQSF-RYGKHSFKGETDPLVAWL--EVPK-- 79
            :|||.|    |:|.:    ||:::|. :|    ||..: ||...:|.......:||.  |||.  
 Frog    14 LNLLAM----FMALM----GLVSYVSLQY----IRMPYGRYADSAFGPPVPVRLAWFVQEVPSLS 66

  Fly    80 -SWFKHFYTFALFWSWLAFYVLVSTVREQKEAPEYVLQFLDIMGGGRSHRKVEIDSTTACVGAFM 143
             |.|  ||.....:| :|..||:............:..|| |.||         ..|.....|..
 Frog    67 VSLF--FYLRQTEFS-IANQVLMGAFICHYTQRTLIFPFL-IRGG---------KPTPFASFALA 118

  Fly   144 LTLQCTRRFYETNFVQIFSKKSKINLSH--YAVGYVHYFGAVIALLSNTSGFVRGSKPMEFSLDK 206
            ....|...:.:::::          .||  ||..::|           ...|:.|.         
 Frog   119 FIFCCYNGYLQSSYL----------CSHAAYASDWIH-----------DPRFITGI--------- 153

  Fly   207 LTSQQILYLGVFFLAWQQQYASNMILVNLRKDPRTGSVKTEKHLLPKGGLFNLLSSPHMFLEVVM 271
                .:.:.|:|...:     |:.||.||||....|      :.:||||||:.:|..:.|.|:|.
 Frog   154 ----MLFFCGMFINIY-----SDRILRNLRKPGEMG------YKIPKGGLFDYVSGANFFGEIVE 203

  Fly   272 Y--FCIADLYMPVRIWRLIFLWVASNQTINALLTHKWYQETFREYPKNRRAIIPFL 325
            :  |.:|...:|...:.:...:|.   |..|...||||.|.|.:|||||:.::|||
 Frog   204 WSGFALAGWSLPAAAFAIFTAFVL---TSRAQQHHKWYLEKFEDYPKNRKILVPFL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7840NP_609203.1 PEMT 77..325 CDD:304400 63/254 (25%)
srd5a1NP_001006841.1 Steroid_dh 108..257 CDD:251363 50/197 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.