DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7840 and ZK1251.3

DIOPT Version :9

Sequence 1:NP_609203.1 Gene:CG7840 / 34136 FlyBaseID:FBgn0032014 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_501719.1 Gene:ZK1251.3 / 191550 WormBaseID:WBGene00014241 Length:253 Species:Caenorhabditis elegans


Alignment Length:317 Identity:76/317 - (23%)
Similarity:124/317 - (39%) Gaps:96/317 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ATIVFFGGLMT----FVEKYLPNSIRQSFRYGKHSFKGETDPLVAWLEVPK--SW----FKHF-Y 86
            |.|:....|||    ||...|.|: .:...||::|     |.|.....:|.  ||    |..| .
 Worm     4 AIIIIGSWLMTTCGIFVFLTLSNT-EKPLGYGRYS-----DSLATTRTLPPTISWMIQGFPSFII 62

  Fly    87 TFALFWSWLAFYVLVSTVREQKEAPEYVLQFLDIMGGGRSHRKVEIDSTTACVGAFMLTLQCTRR 151
            .|.|:|:             .:...||                          |:| ||...|..
 Worm    63 PFYLYWT-------------NQHLTEY--------------------------GSF-LTCLMTFH 87

  Fly   152 FYETNFVQIF----SKKSKINLSHYAVGYVHYFGAVIALLSNTSGFVRGS-----KPMEFSLDKL 207
            :...:||..|    ..:|.:.:...|.|:           |..:||::|:     :| ||  |.|
 Worm    88 YAYRSFVYPFIINSDNQSPVKIVIMAFGF-----------SVLNGFIQGTWNAFYQP-EF--DTL 138

  Fly   208 TSQQILYLG--VFFLAWQQQYASNMILVNLRKDPRTGSVKTEKHLLPKGGLFNLLSSPHMFLEVV 270
            ..:..::||  :|.:.:.....|::.|:.||.|      ....:.:|:|..|..:|.|:.|.|.:
 Worm   139 HPKFFVFLGAWLFVIGFITHCVSDLHLITLRND------YLNSYSIPRGHYFEYISCPNYFGECL 197

  Fly   271 MY--FCIADLYMPVRIWRLIF-LWVASNQTINALLTHKWYQETFRE-YPKNRRAIIP 323
            .:  :.:|....|.    :.| .::..|....|:..|||||:.|.| ||::|.|::|
 Worm   198 QWIGYALAARSFPA----IAFAFFIVCNLAPRAMSHHKWYQKMFGEQYPRDRHALVP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7840NP_609203.1 PEMT 77..325 CDD:304400 62/269 (23%)
ZK1251.3NP_501719.1 Steroid_dh 103..253 CDD:251363 44/172 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.