DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7840 and F19H6.4

DIOPT Version :9

Sequence 1:NP_609203.1 Gene:CG7840 / 34136 FlyBaseID:FBgn0032014 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_510077.1 Gene:F19H6.4 / 184699 WormBaseID:WBGene00008959 Length:243 Species:Caenorhabditis elegans


Alignment Length:326 Identity:79/326 - (24%)
Similarity:119/326 - (36%) Gaps:115/326 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLQM---MFGTFIATIVFFGGLMTFVEKYLPNSIRQSFRYGKHSFKGETDPLVAWL--EVPKSWF 82
            ||.|   |.|  :|.|||......|...|        .||...|..| .:|.:||.  |.|    
 Worm     5 LLTMAWAMIG--MAVIVFLALTRGFTAGY--------GRYADRSKYG-INPKLAWFIQEAP---- 54

  Fly    83 KHFYTFALFWSWLAFYVLVSTVREQKEAPEYVLQFLDIMGGGRSHRKVEIDSTTACVGAFM---- 143
                         ||::           |.|.|:      .|.|:...|:::      ||:    
 Worm    55 -------------AFFI-----------PLYYLR------RGPSNSGYELNA------AFLFHYF 83

  Fly   144 ---LTLQCTRRFYETNFVQIFSKKSKINLSHYAVGYVHYFGAVIALLSNTSGFVRG-----SKPM 200
               |...|..|         .:.||.:.:...|..:..|           :||::|     .:|.
 Worm    84 FRALIYPCRIR---------STTKSPVAIVAAATFFCAY-----------NGFLQGYWNAFYQPE 128

  Fly   201 E-FSLDKLTSQQILYLGVFFLAWQQQYASNMILVNLRKDPRTGSVKTEKHLLPKGGLFNLLSSPH 264
            | ::..||....:...|::.     .:.|:.||..||.|..||      :.:|.|.|:..:|.|:
 Worm   129 EPWTTRKLVGSLMYCTGMYI-----NHKSDTILRELRADGGTG------YKIPTGFLYEYISCPN 182

  Fly   265 M---FLEVVMYFCIADLYMPVRIWRL----IFLWVASNQTINALLTHKWYQETFREYPKNRRAII 322
            .   .:|.:.|..:|        |.|    ..::..:|....|:..||||:|||..||.|||.:|
 Worm   183 YAGEIMEWIGYSILA--------WNLPALAFAIFTIANIGPRAVAHHKWYKETFPGYPPNRRILI 239

  Fly   323 P 323
            |
 Worm   240 P 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7840NP_609203.1 PEMT 77..325 CDD:304400 60/267 (22%)
F19H6.4NP_510077.1 Steroid_dh 97..243 CDD:251363 46/174 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.