DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk and PIN3

DIOPT Version :10

Sequence 1:NP_476745.1 Gene:Btk / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_015480.1 Gene:PIN3 / 856277 SGDID:S000006358 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:106 Identity:26/106 - (24%)
Similarity:47/106 - (44%) Gaps:11/106 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 SLTTFKQSPTLLNGNGTL-------LDANMPGGIPTPGTPNSKAKDNSHFVKLVVALYPFKAIEG 358
            |||..:.....|.|:..:       ::.::|........|.:.:..:..:|:   |||.|...:.
Yeast     9 SLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPASLEYVE---ALYQFDPQQD 70

  Fly   359 GDLSLEKNAEYEVIDDSQEHWWKVKDALGNVGYIPSNYVKP 399
            |||.|:...:.::::.....|:| ....|..|..|:|||||
Yeast    71 GDLGLKPGDKVQLLEKLSPEWYK-GSCNGRTGIFPANYVKP 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtkNP_476745.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 16/52 (31%)
SH2_Tec_family 403..505 CDD:198188
PTKc_Tec_like 521..778 CDD:173637
PIN3NP_015480.1 SH3 58..110 CDD:473055 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.