DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk and LSB1

DIOPT Version :10

Sequence 1:NP_476745.1 Gene:Btk / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:91 Identity:27/91 - (29%)
Similarity:47/91 - (51%) Gaps:10/91 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 LLDANMPGG---------IPTPGTPNSKAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVID 373
            |.::|:..|         :|.....|.::..|:...:.|.|||.|:|.:.|||||:...:.:|::
Yeast    20 LKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLE 84

  Fly   374 DSQEHWWKVKDALGNVGYIPSNYVKP 399
            .....|::.| :...:|..|:|||||
Yeast    85 KISPDWYRGK-SNNKIGIFPANYVKP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtkNP_476745.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 19/52 (37%)
SH2_Tec_family 403..505 CDD:198188
PTKc_Tec_like 521..778 CDD:173637
LSB1NP_011652.1 SH3 55..108 CDD:214620 18/53 (34%)
PRK12323 <100..>156 CDD:481241 7/10 (70%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.