DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and AT1G70130

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_177170.1 Gene:AT1G70130 / 843349 AraportID:AT1G70130 Length:656 Species:Arabidopsis thaliana


Alignment Length:272 Identity:82/272 - (30%)
Similarity:125/272 - (45%) Gaps:51/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 EELGSGQFGVVRRGKW-RGSIDTAVKMMK-EGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHR 592
            |.||.|.||.|.:|.. ..||..|||.:. :......:|:.|...:.:|:||:||:|.|.|.:..
plant   338 EVLGKGGFGKVFKGILPLSSIPIAVKKISHDSRQGMREFLAEIATIGRLRHPDLVRLLGYCRRKG 402

  Fly   593 PIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLD------MCIQVSKGMTYLER---HNYIHRDL 648
            .:|:|.::|..|||       :|.|......:||      :...|:.|:.||.:   ...||||:
plant   403 ELYLVYDFMPKGSL-------DKFLYNQPNQILDWSQRFNIIKDVASGLCYLHQQWVQVIIHRDI 460

  Fly   649 AARNCLVGSENVVKVADFGLAR---YVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYG 710
            ...|.|:......|:.|||||:   :.:|.|.::..||   ..:..||:....:.|:.|||:|:|
plant   461 KPANILLDENMNAKLGDFGLAKLCDHGIDSQTSNVAGT---FGYISPELSRTGKSSTSSDVFAFG 522

  Fly   711 VLMWEIFTCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKE--IYDVMKLCWSHGP-----EERP 768
            |.|.|| |||:.|.|                   |:....|  :.|.:..||..|.     :|:.
plant   523 VFMLEI-TCGRRPIG-------------------PRGSPSEMVLTDWVLDCWDSGDILQVVDEKL 567

  Fly   769 AFRVLMDQLALV 780
            ..|.|.:|:.||
plant   568 GHRYLAEQVTLV 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188
PTKc_Tec_like 521..778 CDD:173637 80/268 (30%)
Pkinase_Tyr 526..777 CDD:285015 79/267 (30%)
AT1G70130NP_177170.1 Lectin_legB 30..262 CDD:365899
STKc_IRAK 340..606 CDD:270968 81/270 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.