DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk and HT1

DIOPT Version :10

Sequence 1:NP_476745.1 Gene:Btk / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_176430.2 Gene:HT1 / 842538 AraportID:AT1G62400 Length:390 Species:Arabidopsis thaliana


Alignment Length:266 Identity:85/266 - (31%)
Similarity:140/266 - (52%) Gaps:21/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 DKWEIHPMELMLMEELGSGQFGVVRRGKWRGSIDTAVKMM-----KEGTMS--EDDFIEEAKVMT 574
            ::|.....:|.:..:..||....:.||.::... .||||:     ||.|.:  |..|..|..:::
plant    77 EEWTADLSQLFIGNKFASGAHSRIYRGIYKQRA-VAVKMVRIPTHKEETRAKLEQQFKSEVALLS 140

  Fly   575 KLQHPNLVQLYGVCSKHRPIY-IVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYL 638
            :|.|||:||....|.| .|:| |:||||..|:|..||.:.|...: ::..:|.:.:.:|:||.||
plant   141 RLFHPNIVQFIAACKK-PPVYCIITEYMSQGNLRMYLNKKEPYSL-SIETVLRLALDISRGMEYL 203

  Fly   639 ERHNYIHRDLAARNCLVGSENVVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSK 703
            .....|||||.:.|.|:..|..|||||||.:  .|:.|...:.|.....:|..||::....::.|
plant   204 HSQGVIHRDLKSNNLLLNDEMRVKVADFGTS--CLETQCREAKGNMGTYRWMAPEMIKEKPYTRK 266

  Fly   704 SDVWAYGVLMWEIFTCGKMPYGRLKNTE----VVERVQRGIILEKPKSCAKEIYDVMKLCWSHGP 764
            .||:::|:::||: |...:|:..:...:    |.|:.:|..:   |.||...:..::|.|||..|
plant   267 VDVYSFGIVLWEL-TTALLPFQGMTPVQAAFAVAEKNERPPL---PASCQPALAHLIKRCWSENP 327

  Fly   765 EERPAF 770
            .:||.|
plant   328 SKRPDF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtkNP_476745.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188
PTKc_Tec_like 521..778 CDD:173637 84/262 (32%)
HT1NP_176430.2 STKc_MAP3K-like 93..340 CDD:270901 83/250 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.