DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and PERK15

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_175639.1 Gene:PERK15 / 841659 AraportID:AT1G52290 Length:509 Species:Arabidopsis thaliana


Alignment Length:199 Identity:63/199 - (31%)
Similarity:102/199 - (51%) Gaps:12/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 LGSGQFGVVRRGKWRGSIDTAVKMMKEGT-MSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIY 595
            ||.|.||.|.||........|:|.:|.|: ..|.:|..|.:.::::.|.:||.|.|.|.......
plant   149 LGQGGFGYVHRGVLVDGTLVAIKQLKSGSGQGEREFQAEIQTISRVHHRHLVSLLGYCITGAQRL 213

  Fly   596 IVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERH---NYIHRDLAARNCLVGS 657
            :|.|::.:.:|..:|...|:.:: .....:.:.:..:||:.||...   ..||||:.|.|.|:..
plant   214 LVYEFVPNKTLEFHLHEKERPVM-EWSKRMKIALGAAKGLAYLHEDCNPKTIHRDVKAANILIDD 277

  Fly   658 ENVVKVADFGLARYVLD-DQYTSSG--GTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTC 719
            ....|:|||||||..|| |.:.|:.  ||   ..:..||..:..:.:.||||::.||::.|:.| 
plant   278 SYEAKLADFGLARSSLDTDTHVSTRIMGT---FGYLAPEYASSGKLTEKSDVFSIGVVLLELIT- 338

  Fly   720 GKMP 723
            |:.|
plant   339 GRRP 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188
PTKc_Tec_like 521..778 CDD:173637 63/199 (32%)
Pkinase_Tyr 526..777 CDD:285015 63/199 (32%)
PERK15NP_175639.1 PKc_like 149..419 CDD:304357 63/199 (32%)
Pkinase_Tyr 149..417 CDD:285015 63/199 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.