Sequence 1: | NP_001097121.1 | Gene: | Btk29A / 34132 | FlyBaseID: | FBgn0003502 | Length: | 786 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_175639.1 | Gene: | PERK15 / 841659 | AraportID: | AT1G52290 | Length: | 509 | Species: | Arabidopsis thaliana |
Alignment Length: | 199 | Identity: | 63/199 - (31%) |
---|---|---|---|
Similarity: | 102/199 - (51%) | Gaps: | 12/199 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 532 LGSGQFGVVRRGKWRGSIDTAVKMMKEGT-MSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIY 595
Fly 596 IVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERH---NYIHRDLAARNCLVGS 657
Fly 658 ENVVKVADFGLARYVLD-DQYTSSG--GTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTC 719
Fly 720 GKMP 723 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Btk29A | NP_001097121.1 | PH_Btk | 44..222 | CDD:269944 | |
SH3_Tec_like | 346..399 | CDD:212702 | |||
SH2_Tec_family | 403..505 | CDD:198188 | |||
PTKc_Tec_like | 521..778 | CDD:173637 | 63/199 (32%) | ||
Pkinase_Tyr | 526..777 | CDD:285015 | 63/199 (32%) | ||
PERK15 | NP_175639.1 | PKc_like | 149..419 | CDD:304357 | 63/199 (32%) |
Pkinase_Tyr | 149..417 | CDD:285015 | 63/199 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 119 | 1.000 | Inparanoid score | I1986 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |