Sequence 1: | NP_001097121.1 | Gene: | Btk29A / 34132 | FlyBaseID: | FBgn0003502 | Length: | 786 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_172580.2 | Gene: | SUB / 837654 | AraportID: | AT1G11130 | Length: | 768 | Species: | Arabidopsis thaliana |
Alignment Length: | 207 | Identity: | 61/207 - (29%) |
---|---|---|---|
Similarity: | 107/207 - (51%) | Gaps: | 21/207 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 532 LGSGQFGVVRRGKWRGSIDTAVKMMK---EGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRP 593
Fly 594 IYIVTEYMKHGSLLNYL---RRHEKTLIGNMGLLLDMCIQVSKGMTYLE---RHNYIHRDLAARN 652
Fly 653 CLVGSENVVKVADFGLARYVLDDQYTSS-GGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEI 716
Fly 717 FTCGKMPYGRLK 728 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Btk29A | NP_001097121.1 | PH_Btk | 44..222 | CDD:269944 | |
SH3_Tec_like | 346..399 | CDD:212702 | |||
SH2_Tec_family | 403..505 | CDD:198188 | |||
PTKc_Tec_like | 521..778 | CDD:173637 | 61/207 (29%) | ||
Pkinase_Tyr | 526..777 | CDD:285015 | 61/207 (29%) | ||
SUB | NP_172580.2 | PLN00113 | <83..765 | CDD:215061 | 61/207 (29%) |
leucine-rich repeat | 95..116 | CDD:275380 | |||
leucine-rich repeat | 117..140 | CDD:275380 | |||
leucine-rich repeat | 141..164 | CDD:275380 | |||
leucine-rich repeat | 165..188 | CDD:275380 | |||
leucine-rich repeat | 189..210 | CDD:275380 | |||
leucine-rich repeat | 211..231 | CDD:275380 | |||
PKc_like | 503..765 | CDD:419665 | 61/207 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 119 | 1.000 | Inparanoid score | I1986 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |