DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and CRLK2

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_001078591.1 Gene:CRLK2 / 831429 AraportID:AT5G15730 Length:436 Species:Arabidopsis thaliana


Alignment Length:364 Identity:92/364 - (25%)
Similarity:149/364 - (40%) Gaps:80/364 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 QSHVKHYHIKQNARCEYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPCDR-----PVPPTAG 513
            :||::....:||:            .|:|    .|....|.:.      |.||     ..||..|
plant    36 RSHLRRCANEQNS------------PTLP----VHTAKRGVVI------PDDRANTESSQPPENG 78

  Fly   514 --LSHDK-WEIHPMELMLMEE--------------------LGSGQFGVVRRGKW-RGSIDTAVK 554
              ..|.. |..|..:|.:...                    ||.|.||.|.:... .|.:..|..
plant    79 APTQHQPWWNNHTKDLTVSASGIPRYNYKDIQKATQNFTTVLGQGSFGPVYKAVMPNGELAAAKV 143

  Fly   555 MMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVC--SKHRPIYIVTEYMKHGSLLNYLRRHEKTL 617
            .....:..:.:|..|..::.:|.|.|||.|.|.|  ..||  .::.|:|.:|||.|.|...|...
plant   144 HGSNSSQGDREFQTEVSLLGRLHHRNLVNLTGYCVDKSHR--MLIYEFMSNGSLENLLYGGEGMQ 206

  Fly   618 IGNMGLLLDMCIQVSKGMTYLERHN-----YIHRDLAARNCLVGSENVVKVADFGLARYVLDDQY 677
            :.|....|.:.:.:|.|:.||  |.     .|||||.:.|.|:......|||||||::.::.|:.
plant   207 VLNWEERLQIALDISHGIEYL--HEGAVPPVIHRDLKSANILLDHSMRAKVADFGLSKEMVLDRM 269

  Fly   678 TSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTC-----GKMPYGRLKN------TE 731
            ||  |.|....:..|..::..:::.|||::::||::.|:.|.     ..|.|..|.:      .|
plant   270 TS--GLKGTHGYMDPTYISTNKYTMKSDIYSFGVIILELITAIHPQQNLMEYINLASMSPDGIDE 332

  Fly   732 VVERVQRG-IILEKPKSCAKEIYDVMKLCWSHGPEERPA 769
            ::::...| ..:|:.:..||    :...|....|.:||:
plant   333 ILDQKLVGNASIEEVRLLAK----IANRCVHKTPRKRPS 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188 9/50 (18%)
PTKc_Tec_like 521..778 CDD:173637 76/289 (26%)
Pkinase_Tyr 526..777 CDD:285015 75/284 (26%)
CRLK2NP_001078591.1 S_TKc 119..373 CDD:214567 74/259 (29%)
STKc_IRAK 120..378 CDD:270968 74/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.