DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and RBK1

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_568231.1 Gene:RBK1 / 830917 AraportID:AT5G10520 Length:467 Species:Arabidopsis thaliana


Alignment Length:464 Identity:111/464 - (23%)
Similarity:184/464 - (39%) Gaps:90/464 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 LSLEKNAEYEVIDDSQEHWWKVKDALGNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAE-SLL 424
            :::|.|...|    |:.| .:|:....::|...|:  .|:.:||:      |.|.....:. |..
plant     1 MAVEDNKNSE----SKNH-QEVELHRNDLGLEDSS--SPRGVLGM------VSDSDNSSSSCSSC 52

  Fly   425 KQGDKEGCFVVRKSSTKGLYTLSLHTKVPQSHVKHYHIKQNARCEYYLSEKHC--CETIPDLINY 487
            ...||       .|||...:  |..||...|  .|:.::.|...| .:.:|..  ...||.|.:|
plant    53 SSDDK-------SSSTSSPF--SNTTKTVSS--SHHGLQWNKMIE-SIKKKSMRRFSVIPLLASY 105

  Fly   488 HRHNSGGLACRLKSSPCDRPVPPTA-GLSHDKWEIHPMELMLM--------EELGSGQFGVVRRG 543
            ..........:.|.:|.:......| .::...|.....|.:.:        ..:|.|....|.:|
plant   106 ELTRKNLRRKQPKLTPSESAFTCEAFFMAKPSWRNFTYEELAVATDYFNPENMIGKGGHAEVYKG 170

  Fly   544 KWRGSIDTAVKMMKEGTMSED----DFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHG 604
            ........|:|.:......|:    ||:.|..::..:.|||..:|.|. |..|.::.|.||..:|
plant   171 VLINGETVAIKKLMSHAKEEEERVSDFLSELGIIAHVNHPNAARLRGF-SSDRGLHFVLEYAPYG 234

  Fly   605 SLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHN-----YIHRDLAARNCLVGSENVVKVA 664
            ||.:.|...|:.|  ...:...:.:.::.|::||  ||     .||||:.|.|.|:..:...:::
plant   235 SLASMLFGSEECL--EWKIRYKVALGIADGLSYL--HNACPRRIIHRDIKASNILLNHDYEAQIS 295

  Fly   665 DFGLARYVLDDQYTSSGGTKFPIK----WAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYG 725
            |||||:: |.:.:...  ..|||:    :..||...:.....|.||:|:|||:.||.|       
plant   296 DFGLAKW-LPENWPHH--VVFPIEGTFGYLAPEYFMHGIVDEKIDVFAFGVLLLEIIT------- 350

  Fly   726 RLKNTEVVERVQRGIIL--EKP---KSCAKEIYD--------------VM---KLCWSHGPEERP 768
               :...|:...|..|:  .||   |:..::|.|              ||   .:|..|....||
plant   351 ---SRRAVDTASRQSIVAWAKPFLEKNSMEDIVDPRLGNMFNPTEMQRVMLTASMCVHHIAAMRP 412

  Fly   769 AFRVLMDQL 777
            ....|:..|
plant   413 DMTRLVQLL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 8/37 (22%)
SH2_Tec_family 403..505 CDD:198188 24/104 (23%)
PTKc_Tec_like 521..778 CDD:173637 76/300 (25%)
Pkinase_Tyr 526..777 CDD:285015 74/293 (25%)
RBK1NP_568231.1 PKc_like 159..421 CDD:419665 74/279 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.