DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and AT4G02630

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_192172.1 Gene:AT4G02630 / 828217 AraportID:AT4G02630 Length:492 Species:Arabidopsis thaliana


Alignment Length:274 Identity:71/274 - (25%)
Similarity:128/274 - (46%) Gaps:53/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 LGSGQFGVVRRGKWRGSIDTAVK-MMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIY 595
            :|.|.:|:|.||........|:| ::.....:|.:|..|.:.:.:::|.|||:|.|.|.:.....
plant   168 IGQGGYGIVYRGVLEDKSMVAIKNLLNNRGQAEKEFKVEVEAIGRVRHKNLVRLLGYCVEGAHRM 232

  Fly   596 IVTEYMKHGSLLNYLRRHEKTLIGNMG--------LLLDMCIQVSKGMTYLE---RHNYIHRDLA 649
            :|.||:.:|:|..::..      |.:|        :.:::.:..:||:.||.   ....:|||:.
plant   233 LVYEYVDNGNLEQWIHG------GGLGFKSPLTWEIRMNIVLGTAKGLMYLHEGLEPKVVHRDIK 291

  Fly   650 ARNCLVGSENVVKVADFGLAR-------YVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVW 707
            :.|.|:..:...||:|||||:       ||.    |...||   ..:..||..:....:.:|||:
plant   292 SSNILLDKQWNSKVSDFGLAKLLGSEMSYVT----TRVMGT---FGYVAPEYASTGMLNERSDVY 349

  Fly   708 AYGVLMWEIFTCGKMP--YGR----------LKNTEVVERVQRGII----LEKP--KSCAKEIYD 754
            ::|||:.||.: |:.|  |.|          ||.. |..|...|::    ::||  :|..:.:..
plant   350 SFGVLVMEIIS-GRSPVDYSRAPGEVNLVEWLKRL-VTNRDAEGVLDPRMVDKPSLRSLKRTLLV 412

  Fly   755 VMKLCWSHGPEERP 768
            .:: |.....::||
plant   413 ALR-CVDPNAQKRP 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188
PTKc_Tec_like 521..778 CDD:173637 71/274 (26%)
Pkinase_Tyr 526..777 CDD:285015 71/274 (26%)
AT4G02630NP_192172.1 STKc_IRAK 168..435 CDD:270968 71/274 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.