DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and AT3G17410

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_001326779.1 Gene:AT3G17410 / 821005 AraportID:AT3G17410 Length:364 Species:Arabidopsis thaliana


Alignment Length:356 Identity:81/356 - (22%)
Similarity:140/356 - (39%) Gaps:71/356 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 CCETIPDLINYHRHNSGGLACRLKSSPCDRPVPPTAGLS--HDKWEIHPMELMLMEE-------- 531
            ||             .||...|..|....:||..|.|.:  |.:....|..|.:::.        
plant     6 CC-------------GGGEDFRRVSETGPKPVHNTGGYNGGHHQRADPPKNLPVIQMQPISVAAI 57

  Fly   532 -----------------LGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHP 579
                             :|.|.:|.|..|..:.....|:|.:......:.:|:.:..::::|:..
plant    58 PADELRDITDNYGSKSLIGEGSYGRVFYGILKSGKAAAIKKLDSSKQPDQEFLAQVSMVSRLRQE 122

  Fly   580 NLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLD------MCIQVSKGMTYL 638
            |:|.|.|.|.......:..||..:|||.:.|...:.......|.:|.      :.:..::|:.||
plant   123 NVVALLGYCVDGPLRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWHQRVKIAVGAARGLEYL 187

  Fly   639 -ERHN--YIHRDLAARNCLVGSENVVKVADFGLARYVLDD----QYTSSGGTKFPIKWAPPEVLN 696
             |:.|  .||||:.:.|.|:..::|.|:|||.|:....|.    ..|...||   ..:..||...
plant   188 HEKANPHVIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGT---FGYHAPEYAM 249

  Fly   697 YTRFSSKSDVWAYGVLMWEIFTCGK-----MPYG----------RLKNTEVVERVQRGIILEKPK 746
            ....|:||||:::||::.|:.|..|     :|.|          :|...:|.:.|...:..|.|.
plant   250 TGTLSTKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSVVTWATPKLSEDKVKQCVDARLNGEYPP 314

  Fly   747 SCAKEIYDVMKLCWSHGPEERPAFRVLMDQL 777
            ....::..|..||..:..:.||...:::..|
plant   315 KAVAKLAAVAALCVQYEADFRPNMSIVVKAL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188 6/27 (22%)
PTKc_Tec_like 521..778 CDD:173637 70/310 (23%)
Pkinase_Tyr 526..777 CDD:285015 68/303 (22%)
AT3G17410NP_001326779.1 PKc_like 75..348 CDD:419665 68/274 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.