DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and STY8

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_179361.1 Gene:STY8 / 816278 AraportID:AT2G17700 Length:546 Species:Arabidopsis thaliana


Alignment Length:303 Identity:99/303 - (32%)
Similarity:173/303 - (57%) Gaps:29/303 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 INYHRHNSGGLACRLKSSPCDRPVP-----PTAGLSHDKWEIHPMELMLMEELGSGQFGVVRRGK 544
            |::..|:        |||  :..:|     ||.|.  |:|||...:|.:.:::.||.:|.:.||.
plant   252 ISFFEHD--------KSS--NELIPACIEIPTDGT--DEWEIDVTQLKIEKKVASGSYGDLHRGT 304

  Fly   545 WRGSIDTAVKMMKEGTMSED---DFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSL 606
            : .|.:.|:|.:|...::.:   :|.:|..:|.|::|.|:||..|.|::...:.||||:|..||:
plant   305 Y-CSQEVAIKFLKPDRVNNEMLREFSQEVFIMRKVRHKNVVQFLGACTRSPTLCIVTEFMARGSI 368

  Fly   607 LNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLARY 671
            .::|  |::.....:..||.:.:.|:|||:||.::|.|||||...|.|:....:|||||||:||.
plant   369 YDFL--HKQKCAFKLQTLLKVALDVAKGMSYLHQNNIIHRDLKTANLLMDEHGLVKVADFGVARV 431

  Fly   672 VLDD-QYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYGRLKNTE-VVE 734
            .::. ..|:..||   .:|..|||:.:..::.|:||::|.:::||:.| |.:||..|...: .|.
plant   432 QIESGVMTAETGT---YRWMAPEVIEHKPYNHKADVFSYAIVLWELLT-GDIPYAFLTPLQAAVG 492

  Fly   735 RVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQL 777
            .||:|:..:.||....::..:::.||...||:||.|..:::.|
plant   493 VVQKGLRPKIPKKTHPKVKGLLERCWHQDPEQRPLFEEIIEML 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188 5/19 (26%)
PTKc_Tec_like 521..778 CDD:173637 87/262 (33%)
Pkinase_Tyr 526..777 CDD:285015 85/255 (33%)
STY8NP_179361.1 ACT_TyrKc 172..239 CDD:153200
Pkinase_Tyr 286..535 CDD:285015 85/255 (33%)
STKc_MAP3K-like 292..535 CDD:270901 84/249 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.