DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk and Fgfr1

DIOPT Version :10

Sequence 1:NP_476745.1 Gene:Btk / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_077060.2 Gene:Fgfr1 / 79114 RGDID:620713 Length:822 Species:Rattus norvegicus


Alignment Length:333 Identity:118/333 - (35%)
Similarity:171/333 - (51%) Gaps:49/333 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 NSGGL---ACRLKSSPCDRPVPPTAGLSH------DKWEIHPMELMLMEELGSGQFGVV------ 540
            |||.|   ..||.||    ..|..||:|.      .:||:....|:|.:.||.|.||.|      
  Rat   438 NSGVLLVRPSRLSSS----GTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAI 498

  Fly   541 --RRGKWRGSIDTAVKMMKEGTMSED--DFIEEAKVMTKL-QHPNLVQLYGVCSKHRPIYIVTEY 600
              .:.|.......||||:|.....:|  |.|.|.::|..: :|.|::.|.|.|::..|:|::.||
  Rat   499 GLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEY 563

  Fly   601 MKHGSLLNYLRRHEKTLIGNMGL------------------LLDMCIQVSKGMTYLERHNYIHRD 647
            ...|:|..||:.....     ||                  |:....||::||.||.....||||
  Rat   564 ASKGNLREYLQARRPP-----GLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRD 623

  Fly   648 LAARNCLVGSENVVKVADFGLARYVLD-DQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGV 711
            |||||.||..:||:|:|||||||.:.. |.|..:...:.|:||..||.|....::.:||||::||
  Rat   624 LAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGV 688

  Fly   712 LMWEIFTCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQ 776
            |:|||||.|..||..:...|:.:.::.|..::||.:|..|:|.:|:.||...|.:||.|:.|::.
  Rat   689 LLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVED 753

  Fly   777 L-ALVAQT 783
            | .:||.|
  Rat   754 LDRIVALT 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtkNP_476745.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188 8/16 (50%)
PTKc_Tec_like 521..778 CDD:173637 101/287 (35%)
Fgfr1NP_077060.2 IgI_1_FGFR 25..118 CDD:409362
Ig strand A 25..28 CDD:409362
Ig strand A' 40..46 CDD:409362
Ig strand B 49..59 CDD:409362
Ig strand C 63..68 CDD:409362
Ig strand C' 71..73 CDD:409362
Ig strand D 78..82 CDD:409362
Ig strand E 85..90 CDD:409362
Ig strand F 96..105 CDD:409362
Ig strand G 108..118 CDD:409362
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..162
IgI_2_FGFR 153..247 CDD:409443
Ig strand A 153..156 CDD:409443
Heparin-binding 160..177
Ig strand A' 164..169 CDD:409443
Ig strand B 173..181 CDD:409443
Ig strand C 187..192 CDD:409443
Ig strand C' 195..197 CDD:409443
Ig strand D 206..209 CDD:409443
Ig strand E 213..218 CDD:409443
Ig strand F 227..234 CDD:409443
Ig strand G 237..247 CDD:409443
Ig 255..359 CDD:472250
Ig strand B 273..277 CDD:409444
Ig strand C 286..290 CDD:409444
Ig strand E 324..328 CDD:409444
Ig strand F 338..343 CDD:409444
Ig strand G 351..354 CDD:409444
PTKc_FGFR1 464..765 CDD:270678 106/303 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 770..822
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.