DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and SRMS

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_543013.1 Gene:SRMS / 6725 HGNCID:11298 Length:488 Species:Homo sapiens


Alignment Length:467 Identity:170/467 - (36%)
Similarity:248/467 - (53%) Gaps:23/467 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 GGIPTPGTPNS-----------KAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQEH 378
            ||.|..|||.|           .|:..|.|.:|.:|||.|.|..||:||:.:......:::...:
Human    23 GGEPDHGTPGSLDPNTDPVPTLPAEPCSPFPQLFLALYDFTARCGGELSVRRGDRLCALEEGGGY 87

  Fly   379 WWKVK-DALGNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDKE-GCFVVRKS-ST 440
            .:..: ....:.|.:|..:|...:...|....||...:||.:|:.||.....| |.|::|.| |:
Human    88 IFARRLSGQPSAGLVPITHVAKASPETLSDQPWYFSGVSRTQAQQLLLSPPNEPGAFLIRPSESS 152

  Fly   441 KGLYTLSLHTKVPQSHVKHYHIKQNARCEYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPCD 505
            .|.|:||:..   |:.|.||.:...|....||.:......:.:|:.|::.|     .:|..:|..
Human   153 LGGYSLSVRA---QAKVCHYRVSMAADGSLYLQKGRLFPGLEELLTYYKAN-----WKLIQNPLL 209

  Fly   506 RPVPPTAGLSHDKWEIHPMELMLMEELGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEA 570
            :|..|......|.||....|..|..:||.|.||.|..|.|.||:..|:|::|...|...|..:|.
Human   210 QPCMPQKAPRQDVWERPHSEFALGRKLGEGYFGEVWEGLWLGSLPVAIKVIKSANMKLTDLAKEI 274

  Fly   571 KVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGM 635
            :.:..|:|..|::|:.|||...|:|||||.|:.|:|..:|...|...: .:..||....||::||
Human   275 QTLKGLRHERLIRLHAVCSGGEPVYIVTELMRKGNLQAFLGTPEGRAL-RLPPLLGFACQVAEGM 338

  Fly   636 TYLERHNYIHRDLAARNCLVGSENVVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRF 700
            :|||....:||||||||.||......|||||||||.:.||.|:.|..:|.|:||..||..||..|
Human   339 SYLEEQRVVHRDLAARNVLVDDGLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANYRVF 403

  Fly   701 SSKSDVWAYGVLMWEIFTCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPE 765
            |.|||||::|||:.|:||.|:.||..:.|.|.::::.||..|.:|.:|..|:|.:|..||...||
Human   404 SQKSDVWSFGVLLHEVFTYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPE 468

  Fly   766 ERPAFRVLMDQL 777
            |||:|..|.::|
Human   469 ERPSFATLREKL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 13/53 (25%)
SH2_Tec_family 403..505 CDD:198188 30/103 (29%)
PTKc_Tec_like 521..778 CDD:173637 112/257 (44%)
Pkinase_Tyr 526..777 CDD:285015 110/250 (44%)
SRMSNP_543013.1 SH3_Srms 55..109 CDD:212780 13/53 (25%)
SH2 119..197 CDD:301589 25/80 (31%)
PTKc_Srm_Brk 223..483 CDD:133248 114/259 (44%)
STYKc 232..480 CDD:214568 110/248 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.