DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and BLK

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:XP_011542126.1 Gene:BLK / 640 HGNCID:1057 Length:531 Species:Homo sapiens


Alignment Length:482 Identity:185/482 - (38%)
Similarity:271/482 - (56%) Gaps:46/482 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 TPGTPNSKAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKDAL-GNVGYI 392
            ||..|:....::.||   |||||.:.|:...||.:.|..:.:|:..:.: ||..:..: |..||:
Human    48 TPPPPDEHLDEDKHF---VVALYDYTAMNDRDLQMLKGEKLQVLKGTGD-WWLARSLVTGREGYV 108

  Fly   393 PSNYVKPKALLGLERYEWYVGDMSRQRAE-SLLKQGDKEGCFVVRKSST-KGLYTLSLHTKVPQS 455
            |||:|.....|.:||  |:.....|:.|| .||...:|.|.|::|:|.| ||.::||:.....|.
Human   109 PSNFVARVESLEMER--WFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQG 171

  Fly   456 H-VKHYHIKQNARCEYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPCDRPVP--PTAGLSHD 517
            . :|||.|:......||:|.:....::..|:.::.....|| |:..:.||.||.|  |.|   .|
Human   172 ELIKHYKIRCLDEGGYYISPRITFPSLQALVQHYSKKGDGL-CQRLTLPCVRPAPQNPWA---QD 232

  Fly   518 KWEIHPMELMLMEELGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLV 582
            :|||....|.|:.:|||||||.|..|.::.::..|:|.:||||||.:.|:.||.||..|||..||
Human   233 EWEIPRQSLRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLV 297

  Fly   583 QLYGVCSKHRPIYIVTEYMKHGS--------------------------LLNYLRRHEKTLIGNM 621
            :||.|.:| .|||||||||..|.                          ||::|:..|.:.: ::
Human   298 RLYAVVTK-EPIYIVTEYMARGGAPRRAASSERGGRAGLSRRRRVRCGCLLDFLKTDEGSRL-SL 360

  Fly   622 GLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLARYVLDDQYTSSGGTKFP 686
            ..|:||..|:::||.|:||.|.|||||.|.|.||......|:||||||| ::|.:||:..|.|||
Human   361 PRLIDMSAQIAEGMAYIERMNSIHRDLRAANILVSEALCCKIADFGLAR-IIDSEYTAQEGAKFP 424

  Fly   687 IKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKE 751
            |||..||.:::..|:.|:|||::|||:.|:.|.|::||..:.|.||:..::||..:.:|.:|..|
Human   425 IKWTAPEAIHFGVFTIKADVWSFGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPE 489

  Fly   752 IY-DVMKLCWSHGPEERPAFRVLMDQL 777
            :| .|:..||...|||||.|..|...|
Human   490 LYRGVIAECWRSRPEERPTFEFLQSVL 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 19/53 (36%)
SH2_Tec_family 403..505 CDD:198188 32/104 (31%)
PTKc_Tec_like 521..778 CDD:173637 120/284 (42%)
Pkinase_Tyr 526..777 CDD:285015 118/277 (43%)
BLKXP_011542126.1 SH3_Blk 62..115 CDD:212942 20/56 (36%)
SH2_Src_Blk 120..219 CDD:198234 30/101 (30%)
PKc_like 233..522 CDD:304357 122/287 (43%)
Pkinase_Tyr 241..516 CDD:285015 118/277 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.