DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and Matk

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:XP_038935769.1 Gene:Matk / 60450 RGDID:69058 Length:496 Species:Rattus norvegicus


Alignment Length:500 Identity:154/500 - (30%)
Similarity:242/500 - (48%) Gaps:82/500 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 IPT----PGTPNSKAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQE-HWWKVK-DA 385
            :||    |||......:||.         |    :.|:|:..|.....:::..:: .|::.| .:
  Rat     1 MPTQRWAPGTQCMTKCENSR---------P----KPGELAFRKGDMVTILEACEDKSWYRAKHHS 52

  Fly   386 LGNVGYIPSNYVKPKALLG----LERYEWYVGDMSRQRAESLLKQGDKEGCFVVRKSST-KGLYT 445
            .|..|.:.:..::.:..|.    |....|:.|.:|.|.|...| |..::|.|:||:|:. .|.|.
  Rat    53 SGQEGLLAAAALRQREALSTDPKLSLMPWFHGKISGQEAIQQL-QPPEDGLFLVRESARHPGDYV 116

  Fly   446 LSLHTKVPQSHVKHYHIKQNARCEYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPCDRPVPP 510
            |.:..   ...|.||.:..... ...:.|..|...:.|::.::..:.|.:        |.:.|.|
  Rat   117 LCVSF---GRDVIHYRVLHRDG-HLTIDEAVCFCNLMDMVEHYTRDKGAI--------CTKLVKP 169

  Fly   511 ---------TAGLSHDKWEIHPMELMLMEELGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDF 566
                     ...|:...|.:....|.|..::|.|:||.|.:|::.|. ..|||.:| ..::...|
  Rat   170 KRKQGAKSAEEELAKAGWLLDLQHLTLGAQIGEGEFGAVLQGEYLGQ-KVAVKNIK-CDVTAQAF 232

  Fly   567 IEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQV 631
            ::|..|||||||.|||:|.||. .|..:|||.|::..|:|:|:||...:.|: :...||...:.|
  Rat   233 LDETAVMTKLQHRNLVRLLGVI-LHHGLYIVMEHVSKGNLVNFLRTRGRALV-STSQLLQFALHV 295

  Fly   632 SKGMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLN 696
            ::||.|||....:||||||||.||..:.|.||:|||||:..|.....||   :.|:||..||.|.
  Rat   296 AEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAELRKGLDSS---RLPVKWTAPEALK 357

  Fly   697 YTRFSSKSDVWAYGVLMWEIFTCGKMPYGRLKNT-----------------------------EV 732
            ..|||||||||::|||:||:|:.|:.||.::.::                             ||
  Rat   358 NGRFSSKSDVWSFGVLLWEVFSYGRAPYPKMVSSTPGRAACASRVTDCPHPCYPLPPYLQSLKEV 422

  Fly   733 VERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQL 777
            .|.|::|..:|.|.||...::.:|..||...|..||.||.::::|
  Rat   423 SEAVEKGYRMEPPDSCPGPVHTLMGSCWEAEPSRRPPFRKIVEKL 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 8/54 (15%)
SH2_Tec_family 403..505 CDD:198188 24/106 (23%)
PTKc_Tec_like 521..778 CDD:173637 109/285 (38%)
Pkinase_Tyr 526..777 CDD:285015 109/279 (39%)
MatkXP_038935769.1 SH3 9..67 CDD:418401 12/70 (17%)
SH2_csk_like 77..174 CDD:198190 25/109 (23%)
PKc_like 187..470 CDD:419665 110/287 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.