DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and Abl

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_001261962.1 Gene:Abl / 45821 FlyBaseID:FBgn0000017 Length:1723 Species:Drosophila melanogaster


Alignment Length:696 Identity:246/696 - (35%)
Similarity:354/696 - (50%) Gaps:114/696 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VRLVEEATVSGEGGDPFAPDGYPFQVGYCEISASAN---SHQLENGNGGGSGVGIE----GQQSG 154
            |..|....:|...|...||.|....:....|.:|::   |.....|.|||||.|:.    |.:..
  Fly    32 VASVSPHCISSSSGVSSAPLGGGSTLRGSRIKSSSSGVASGSGSGGGGGGSGSGLSQRSGGHKDA 96

  Fly   155 RAVPQYTLYVIANSEKERSEWIRAIRQVCEDSNTP-KSYRYHPGLWSGKKWSCCKGLSRTTFGCR 218
            |..|...|.:..                 |.:.|. .|:|.||    ||.....:.|.::    |
  Fly    97 RCNPTVGLNIFT-----------------EHNGTKHSSFRGHP----GKYHMNLEALLQS----R 136

  Fly   219 AAAHWREANNNPSNGSSPAQNSTRSISPNSSTTNSQFSLQHNSSGSLGGGVGGGLGGGGSLGLGG 283
            ...|            .||.::..|:..:::      .||.:...|            |.|||.|
  Fly   137 PLPH------------IPAGSTAASLLADAA------ELQQHQQDS------------GGLGLQG 171

  Fly   284 GGGGGGSCTPTSLQPQSSLTTFKQSPTLLNGNGTLLDANMPGGIPTPGTPNSKAKDNSHFVKLVV 348
            ...|||..:.||:...:...|.|::         ||   .||  |....|           :|.|
  Fly   172 SSLGGGHSSTTSVFESAHRWTSKEN---------LL---APG--PEEDDP-----------QLFV 211

  Fly   349 ALYPFKAIEGGD--LSLEKNAEYEVID-DSQEHWWKVKDALGNVGYIPSNYVKPKALLGLERYEW 410
            |||.|:|  ||:  |||:|..:..::. :....|.:.....||||::|||||.|  |..||::.|
  Fly   212 ALYDFQA--GGENQLSLKKGEQVRILSYNKSGEWCEAHSDSGNVGWVPSNYVTP--LNSLEKHSW 272

  Fly   411 YVGDMSRQRAESLLKQGDKEGCFVVRKS-STKGLYTLSLHTKVPQSHVKHYHIKQNARCEYYLSE 474
            |.|.:||..||.||..| ..|.|:||:| |:.|..::||..   :..|.||.|.::...:.::::
  Fly   273 YHGPISRNAAEYLLSSG-INGSFLVRESESSPGQRSISLRY---EGRVYHYRISEDPDGKVFVTQ 333

  Fly   475 KHCCETIPDLINYHR--HNSGGLACRL------KSSPCDRPVPPTAGLSHDKWEIHPMELMLMEE 531
            :....|:.:|:::|.  |...||...|      ::.|...|:.|    ..|:|||...::|:..:
  Fly   334 EAKFNTLAELVHHHSVPHEGHGLITPLLYPAPKQNKPTVFPLSP----EPDEWEICRTDIMMKHK 394

  Fly   532 LGSGQFGVVRRGKWRGSIDT-AVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIY 595
            ||.||:|.|....|:...:| |||.:||.||:..||:|||.:|.:::|||||||.|||::..|.|
  Fly   395 LGGGQYGEVYEAVWKRYGNTVAVKTLKEDTMALKDFLEEAAIMKEMKHPNLVQLIGVCTREPPFY 459

  Fly   596 IVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENV 660
            |:||:|.||:||::||...:..:..:.||. |..|::.||:|||..|||||||||||||||...:
  Fly   460 IITEFMSHGNLLDFLRSAGRETLDAVALLY-MATQIASGMSYLESRNYIHRDLAARNCLVGDNKL 523

  Fly   661 VKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYG 725
            ||||||||||.:.||.||:..|.||||||..||.|.|.:||:||||||:|||:|||.|.|..||.
  Fly   524 VKVADFGLARLMRDDTYTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATYGMSPYP 588

  Fly   726 RLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFR 771
            .:..|:|..::.:|..:|:|..|..|:||:|:.||.....:||.|:
  Fly   589 AIDLTDVYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDRPTFK 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944 31/132 (23%)
SH3_Tec_like 346..399 CDD:212702 23/55 (42%)
SH2_Tec_family 403..505 CDD:198188 33/110 (30%)
PTKc_Tec_like 521..778 CDD:173637 127/252 (50%)
Pkinase_Tyr 526..777 CDD:285015 126/247 (51%)
AblNP_001261962.1 SH3_Abl 209..263 CDD:212784 23/55 (42%)
SH2_ABL 268..363 CDD:198189 31/98 (32%)
PTKc_Abl 382..644 CDD:270645 129/254 (51%)
Pkinase_Tyr 389..640 CDD:285015 126/247 (51%)
FABD 1584..1723 CDD:197885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468351
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D17578at33392
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.