DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and wnd

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster


Alignment Length:292 Identity:92/292 - (31%)
Similarity:146/292 - (50%) Gaps:25/292 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   504 CDRPVPPTAGLS---------HDKWEIHPMELMLMEELGSGQFGVVRRGKWRGSIDTAVKMMKEG 559
            |.:||....|.:         .:.|:|....:..:|.||||..|.|..|:.:.. ..|||.:|| 
  Fly   130 CMKPVLSFIGKTGVIEVKSQRSEDWQIPFESITELEWLGSGAQGAVFSGRLKNE-TVAVKKVKE- 192

  Fly   560 TMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLL 624
             :.|.|.    |.:.||.|.|:::..|||::.....|:.|:..:|.|.|.|:..:..|...   |
  Fly   193 -LKETDI----KHLRKLDHENIIKFKGVCTQSPVFCIIMEFCPYGPLQNILKEEQVMLPSR---L 249

  Fly   625 LDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLARYVLD-DQYTSSGGTKFPIK 688
            :....|::.||.||..|..|||||.:.|.|:.:..|||::|||.:|...: ....|..||   :.
  Fly   250 VSWSKQIALGMQYLHSHKIIHRDLKSPNILISTNEVVKISDFGTSREWNEISTKMSFAGT---VA 311

  Fly   689 WAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYGRLKNTEVVERV-QRGIILEKPKSCAKEI 752
            |..|||:.....|.|.|:|:|||::||:.|| ::||..:.::.::..| ...:.|..|.:|.:..
  Fly   312 WMAPEVIRNEPCSEKVDIWSYGVVLWEMLTC-EIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEGF 375

  Fly   753 YDVMKLCWSHGPEERPAFRVLMDQLALVAQTL 784
            ..::||||...|..||:||.::..|.:....|
  Fly   376 KLLVKLCWKSKPRNRPSFRQILSHLDIAGPEL 407

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702