DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk and GRAPL

DIOPT Version :10

Sequence 1:NP_476745.1 Gene:Btk / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:XP_016880125.1 Gene:GRAPL / 400581 HGNCID:37240 Length:144 Species:Homo sapiens


Alignment Length:118 Identity:36/118 - (30%)
Similarity:67/118 - (56%) Gaps:9/118 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 VALYPFKAIEGGDLSLEKNAEYEVID-DSQEHWWKVKDALGNVGYIPSNYVKPKALLGLERYEWY 411
            ||||.|:|.|..:|:..|....:::: :..::|:|. :..|..|:||.||::.|.      :.||
Human     4 VALYSFQATESDELAFNKGDTLKILNMEDDQNWYKA-ELRGVEGFIPKNYIRVKP------HPWY 61

  Fly   412 VGDMSRQRAESLLKQGDKEGCFVVRKS-STKGLYTLSLHTKVPQSHVKHYHIK 463
            .|.:|||.||.:|.:.:..|.|::|:| |:.|.:::|:..:.....:.|..:|
Human    62 SGRISRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVKLECSGVIMAHCSLK 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtkNP_476745.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 17/51 (33%)
SH2_Tec_family 403..505 CDD:198188 18/62 (29%)
PTKc_Tec_like 521..778 CDD:173637
GRAPLXP_016880125.1 SH3_GRAP_N 2..55 CDD:212881 17/51 (33%)
SH2 56..>104 CDD:472789 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.