DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and LCK

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:XP_024302814.1 Gene:LCK / 3932 HGNCID:6524 Length:567 Species:Homo sapiens


Alignment Length:575 Identity:211/575 - (36%)
Similarity:304/575 - (52%) Gaps:96/575 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 EANNNPSNGSSPAQNSTRSISPNSSTTNSQFSLQHNSSGSLGGGVGGGLGGGGSLGLGGGGGGGG 289
            |.:|.|   :||.|...|           |..|:..:.|||..|                     
Human    52 EGSNPP---ASPLQGDPR-----------QQGLKDKACGSLAVG--------------------- 81

  Fly   290 SCTPTSLQPQSSLTTFKQSPT-LLNGNGTLLDANM-PGGIPTPG---------TPNSKAKDNSHF 343
                           |..||| .|.|...|:...: ||.:|.|.         |.|         
Human    82 ---------------FHLSPTYFLPGLAFLVPHPVTPGFLPIPARFSLMPLVFTDN--------- 122

  Fly   344 VKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKD-ALGNVGYIPSNYVKPKALLGLER 407
              ||:||:.::....|||..||..:..:::.|.| |||.:. ..|..|:||.|:| .|| ..||.
Human   123 --LVIALHSYEPSHDGDLGFEKGEQLRILEQSGE-WWKAQSLTTGQEGFIPFNFV-AKA-NSLEP 182

  Fly   408 YEWYVGDMSRQRAE-SLLKQGDKEGCFVVRKS-STKGLYTLSLHTKVPQSH---VKHYHIKQNAR 467
            ..|:..::||:.|| .||..|:..|.|::|:| ||.|.::||:. ...|:.   ||||.|:....
Human   183 EPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVR-DFDQNQGEVVKHYKIRNLDN 246

  Fly   468 CEYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPC--DRPVPPTAGLSHDKWEIHPMELMLME 530
            ..:|:|.:.....:.:|:.::.:.|.||..|| |.||  .:|..|   ...|:||:....|.|:|
Human   247 GGFYISPRITFPGLHELVRHYTNASDGLCTRL-SRPCQTQKPQKP---WWEDEWEVPRETLKLVE 307

  Fly   531 ELGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIY 595
            .||:||||.|..|.:.|....|||.:|:|:||.|.|:.||.:|.:|||..||:||.|.:: .|||
Human   308 RLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQ-EPIY 371

  Fly   596 IVTEYMKHGSLLNYLRRHEKTLIG---NMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGS 657
            |:||||::|||:::|    ||..|   .:..||||..|:::||.::|..|||||||.|.|.||..
Human   372 IITEYMENGSLVDFL----KTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSD 432

  Fly   658 ENVVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKM 722
            ....|:|||||||.:.|::||:..|.||||||..||.:||..|:.|||||::|:|:.||.|.|::
Human   433 TLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRI 497

  Fly   723 PYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQL 777
            ||..:.|.||::.::||..:.:|.:|.:|:|.:|:|||...||:||.|..|...|
Human   498 PYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVL 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 20/53 (38%)
SH2_Tec_family 403..505 CDD:198188 36/108 (33%)
PTKc_Tec_like 521..778 CDD:173637 122/260 (47%)
Pkinase_Tyr 526..777 CDD:285015 121/253 (48%)
LCKXP_024302814.1 SH3_Lck 123..176 CDD:212938 20/54 (37%)
SH2_Src_Lck 181..281 CDD:198225 33/101 (33%)
PTKc_Lck_Blk 295..558 CDD:270652 124/263 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.