DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and JAK3

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_000206.2 Gene:JAK3 / 3718 HGNCID:6193 Length:1124 Species:Homo sapiens


Alignment Length:440 Identity:130/440 - (29%)
Similarity:196/440 - (44%) Gaps:71/440 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 VKPKALLGLE----RYEWYVGDMSRQRAESLLKQGDKEGCFVVRKSSTKGLYTLSLHTKVPQSHV 457
            |.| |:|.||    |..|...:..|: |::|..:.||.|..........|: |:.:....|...:
Human   674 VSP-AVLSLEMLTDRIPWVAPECLRE-AQTLSLEADKWGFGATVWEVFSGV-TMPISALDPAKKL 735

  Fly   458 KHYHIKQNARC----EYYLSEKHCC-----------ETIPDL-----INYHRHNSGGLACRLKSS 502
            :.|..:|....    |..|..:.|.           ..|.||     .:|          .|.|.
Human   736 QFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSLISSDY----------ELLSD 790

  Fly   503 PCDRPVPPTAGL--------SHDKWEIHPMELMLMEELGSGQFGVVR------RGKWRGSIDTAV 553
            |....:.|..||        ..|........|..:.:||.|.||.|.      .|...|::....
Human   791 PTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVK 855

  Fly   554 KMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVC--SKHRPIYIVTEYMKHGSLLNYLRRHEKT 616
            ::...|...:.||..|.:::..|....:|:..||.  ...:.:.:|.||:..|.|.::|:||...
Human   856 QLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRAR 920

  Fly   617 LIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLARYV-LD-DQYTS 679
            |..:..||...  |:.|||.||.....:||||||||.||.||..||:||||||:.: || |.|..
Human   921 LDASRLLLYSS--QICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVV 983

  Fly   680 SGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFT-CGK-----MPYGRLKNTE------- 731
            ....:.||.|..||.|:...||.:||||::||:::|:|| |.|     ..:.|:...|       
Human   984 REPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGCERDVPALC 1048

  Fly   732 -VVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQLALV 780
             ::|.::.|..|..|.:|..|::::|||||:..|::||:|..|..||.::
Human  1049 RLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDML 1098

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 1/1 (100%)
SH2_Tec_family 403..505 CDD:198188 26/125 (21%)
PTKc_Tec_like 521..778 CDD:173637 96/280 (34%)
Pkinase_Tyr 526..777 CDD:285015 95/274 (35%)
JAK3NP_000206.2 Interaction with cytokine/interferon/growth hormone receptors. /evidence=ECO:0000250 1..223
B41 39..>200 CDD:214604
PH-like 250..362 CDD:302622
SH2_Jak3 362..458 CDD:198243
PTK_Jak3_rpt1 521..778 CDD:271110 24/106 (23%)
Pkinase_Tyr 521..777 CDD:285015 23/105 (22%)
PTKc_Jak3_rpt2 817..1099 CDD:270665 97/284 (34%)
Pkinase_Tyr 822..1095 CDD:285015 95/274 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.