DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and Ack-like

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster


Alignment Length:445 Identity:132/445 - (29%)
Similarity:200/445 - (44%) Gaps:93/445 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 YEVIDDS--QEHWWKVKDALGNVGYIPSNYVKPKAL--LGLERYEWYVGDMSRQRAESLLKQGDK 429
            ||.:.:|  |:::..||:.|.........|...:.|  :||.|.|     :.|.|          
  Fly     9 YEFLTESELQQYYNAVKNELKITNAAQFKYAADEDLRFIGLSRPE-----IRRLR---------- 58

  Fly   430 EGCFVVRKSSTKGLYTLSLHTKVPQSHVKHYHIKQNARCEYYLSE-KHCCETIPDLINYHRHNSG 493
                                 |..:.|..|          .|||: |...:....::.......|
  Fly    59 ---------------------KFYEKHFPH----------SYLSKIKRLLQAPGTMVKREEAPGG 92

  Fly   494 GLACRL---KSSPCDRPVPPTAGLS-----HDKWEIHPMELMLMEELGSGQFGVVRRGKWRGS-- 548
            |....|   .:|.|..........|     ::|..|....:.:.::||:|:||:|::|.|...  
  Fly    93 GSQVALDGSSASACSSLAAKNGASSPSKVPNNKHIIPADSISVNKQLGTGEFGIVQQGVWSNGNE 157

  Fly   549 -IDTAVKMMKEGTMSED--DFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYL 610
             |..|:|.:....|..:  :|::||.:|..::|.|:|:||||......:.:|||.....|||..|
  Fly   158 RIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECL 222

  Fly   611 RRHEKTLIGNMGL---------LLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENVVKVADF 666
            :        :.||         |.:..:|:..||.|||:...|||||||||.||.|::.||::||
  Fly   223 K--------DSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDF 279

  Fly   667 GLARY--VLDDQYTSSGGT--KFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYGRL 727
            ||:|.  |..|.|.::...  |.||.|..||.:||.||::.|||||:||.:||:|:.|..|:..|
  Fly   280 GLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAAL 344

  Fly   728 KNTEVVERV-----QRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQL 777
            ...:::|.:     ||   ||:|..|..|.|.:|..||.....:||.|..:.|||
  Fly   345 TGLQILEAIDAPNYQR---LEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEIYDQL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 8/31 (26%)
SH2_Tec_family 403..505 CDD:198188 17/105 (16%)
PTKc_Tec_like 521..778 CDD:173637 103/280 (37%)
Pkinase_Tyr 526..777 CDD:285015 100/273 (37%)
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938 16/91 (18%)
STYKc 133..396 CDD:214568 100/273 (37%)
PTKc_Ack_like 137..398 CDD:270636 102/271 (38%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24418
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.