DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and Blk

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:XP_006252250.1 Gene:Blk / 364403 RGDID:1308859 Length:554 Species:Rattus norvegicus


Alignment Length:617 Identity:209/617 - (33%)
Similarity:306/617 - (49%) Gaps:111/617 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 IRQVCEDSNTPKSYRYHPGLWSGKKWSCCKGLSRTTFGCRAAAHWREANNNPSNGSSPA------ 237
            :|.:.|:.:|||.      ||....|                     ..::..:.|.|.      
  Rat    16 LRPLAEEVSTPKR------LWRQLSW---------------------GRDSAESASMPCGLLRLF 53

  Fly   238 -----QNSTRSISPNSSTTNSQFSLQHNSSGSLGGGVGGGLGGGGSLGLGGGGGGGGSCTPTSLQ 297
                 .:|.|.||..|   .|...::..:.|.:                           |..|.
  Rat    54 LRMGLLSSKRQISEKS---KSWSPVKARAQGKV---------------------------PPPLP 88

  Fly   298 PQSSLTTFKQSPTLLNGNGTLLDANMPGGIPTPGTPNSKAKDNSHFVKLVVALYPFKAIEGGDLS 362
            |   |..|...|                    |.:||....:...|   ||||:.:.|:...||.
  Rat    89 P---LVVFNHLP--------------------PPSPNQHPDEEERF---VVALFDYAAVNDRDLQ 127

  Fly   363 LEKNAEYEVIDDSQEHWWKVKDAL-GNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAE-SLLK 425
            :.|..:.:|:..:.: ||..:..: |..||:|||:|.|...|.:|:  |:...:||:.|| .||.
  Rat   128 VLKGEKLQVLKSTGD-WWLARSLVTGREGYVPSNFVAPVETLEVEK--WFFRTISRKDAERQLLA 189

  Fly   426 QGDKEGCFVVRKS-STKGLYTLSLHTKVPQSH-VKHYHIKQNARCEYYLSEKHCCETIPDLINYH 488
            ..:|.|.|::|:| |.||.::||:.....|.. ||||.|:......||:|.:....|:..|:.::
  Rat   190 PMNKAGSFLIRESESNKGAFSLSVKDVTSQGEMVKHYKIRSLDNGGYYISPRITFPTLQALVQHY 254

  Fly   489 RHNSGGLACRLKSSPCDRPVP--PTAGLSHDKWEIHPMELMLMEELGSGQFGVVRRGKWRGSIDT 551
            .....|| |:..:.||..|.|  |.|   .|:|||....|.|:.:|||||||.|..|.::.::..
  Rat   255 SEKGDGL-CQKLTLPCVNPAPKNPWA---QDEWEIPRQSLKLVRKLGSGQFGEVWMGYYKNNMKV 315

  Fly   552 AVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKT 616
            |:|.:||||||.:.|:.||.||..|||..||:||.|.:: .|||||||||..|.||::|:..|.:
  Rat   316 AIKTLKEGTMSPEAFLGEANVMKTLQHERLVRLYAVVTR-EPIYIVTEYMARGCLLDFLKTDEGS 379

  Fly   617 LIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLARYVLDDQYTSSG 681
            .: ::..|:||..||::||.|:||.|.|||||.|.|.||......|:||||||| ::|.:||:..
  Rat   380 RL-SLPRLIDMSAQVAEGMAYIERMNSIHRDLRAANILVSETLCCKIADFGLAR-IIDSEYTAQE 442

  Fly   682 GTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYGRLKNTEVVERVQRGIILEKPK 746
            |.||||||..||.:::..|:.|:|||::|||:.||.|.|::||..:.|.||:..::.|..:..|:
  Rat   443 GAKFPIKWTAPEAIHFGVFTIKADVWSFGVLLMEIVTYGRVPYPGMSNPEVIRSLEHGYRMPCPE 507

  Fly   747 SCAKEIY-DVMKLCWSHGPEERPAFRVLMDQL 777
            :|..|:| ||:..||...|||||.|..|...|
  Rat   508 TCPPELYHDVITECWRGRPEERPTFEFLQSVL 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944 8/42 (19%)
SH3_Tec_like 346..399 CDD:212702 18/53 (34%)
SH2_Tec_family 403..505 CDD:198188 34/104 (33%)
PTKc_Tec_like 521..778 CDD:173637 121/258 (47%)
Pkinase_Tyr 526..777 CDD:285015 119/251 (47%)
BlkXP_006252250.1 SH3 111..164 CDD:302595 19/56 (34%)
SH2 169..268 CDD:301589 32/101 (32%)
PKc_like 282..545 CDD:304357 123/261 (47%)
Pkinase_Tyr 290..539 CDD:285015 119/251 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.