DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and CG10702

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_001188841.1 Gene:CG10702 / 35181 FlyBaseID:FBgn0032752 Length:946 Species:Drosophila melanogaster


Alignment Length:570 Identity:99/570 - (17%)
Similarity:186/570 - (32%) Gaps:187/570 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 GCRAAAHW------REANNNPSNGSSPAQNSTRSISPNSSTTNSQFSLQHNSSGSLGGGVGGGLG 274
            ||.::..|      |..|.|.:|   |..|.      |:.........::|||......|..|| 
  Fly   181 GCSSSHCWSNHYCQRSINENVAN---PKANI------NACHEECLGGCKNNSSSPADCSVCRGL- 235

  Fly   275 GGGSLGLGGGGGGGGSCTPTSLQPQSSLTTFKQSPT-----LLNG---NGTLLDANMPGGIPTPG 331
                       ...|.|..:..:.:..:..:::..|     |.:|   :|:...|..|.|..|  
  Fly   236 -----------SDDGVCVKSCPKDKYVMENYQRCYTKAECVLKHGYVISGSQCVAFCPSGYKT-- 287

  Fly   332 TPNSKAK-----DNSHFVKLVVALYPFKAIEGGDLSLEKNAE-------------YEVIDDSQ-- 376
              |::::     .:...:......:|.||....:|:..:|..             ...::::|  
  Fly   288 --NNRSECVLCSPDEACISFCTPEWPGKAFTVYNLADAENLRGCQIFNGSLVITIRNKVNETQLY 350

  Fly   377 EHWWKVKDALGNVGYIPSNYVKP-KALLGLERYEWYVGDMSRQRAESLLKQGDKE---------- 430
            :.:..:::..|:|....|:.::. :.|..|||..   ||....|..|.:...:||          
  Fly   351 QSFTSMREVRGHVKVYRSSQLRSLQFLRNLERVH---GDPLENRHYSFILYDNKELSELWTPSRQ 412

  Fly   431 ------GCFVVRKSSTKGLYTLSLHTKVPQSHVKHYHI-------KQNARC-----EYYLSEKHC 477
                  |.|:.|.:.     ..:...:..|:.|.|...       .|..:|     :.|:.::  
  Fly   413 LEFMEGGMFMHRNNK-----LCNRRMREFQNAVTHDRALDSLQTNDQEVQCSPLKLQLYVQKR-- 470

  Fly   478 CETIPDLINYHRHNSGGLACRLKSSPCD------RPVPPTAGLSHDKWEIHPMELMLMEELGSGQ 536
                       .|.|..|:. |||....      ||:.| ..|.|::.|:              .
  Fly   471 -----------THRSVKLSW-LKSQTSQKIELIHRPLLP-GKLYHEESEL--------------D 508

  Fly   537 FGVVRRGKWRGSIDTAVKMMKEGT---MSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRP----- 593
            ..:..|..|:..:.....:::.||   ...||...:.:.:.      |::.:|....|..     
  Fly   509 APICTRINWKRRLLFPDDLIENGTHYLFDLDDLQPDTRYVV------LLRTFGNDEAHEAYEARS 567

  Fly   594 --IYIVTEY-MKHGSLLNYLRRHEKTLIGNM------GLLLDMCIQVSKGMTYLERHNYIHR--- 646
              .|:.||. :....||..:::.:.:|...|      ..||.: .::|....|:|:.||.|:   
  Fly   568 ELTYVQTELDIPKPPLLELVKKTDSSLTVQMASHDHVSFLLTV-FELSDDQDYIEQRNYCHQPSY 631

  Fly   647 -----------------DLAARNCLVGSENVVKVADFGLARYVLD--DQY 677
                             |..|:          |...|..:|::.|  :||
  Fly   632 VWQDMDGPRWMAYEDYDDCCAQ----------KAEQFEDSRFIADMREQY 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944 2/5 (40%)
SH3_Tec_like 346..399 CDD:212702 9/67 (13%)
SH2_Tec_family 403..505 CDD:198188 24/129 (19%)
PTKc_Tec_like 521..778 CDD:173637 32/196 (16%)
Pkinase_Tyr 526..777 CDD:285015 32/191 (17%)
CG10702NP_001188841.1 Recep_L_domain 47..159 CDD:279382
Furin-like 171..297 CDD:279142 27/140 (19%)
FU 210..258 CDD:238021 8/59 (14%)
Recep_L_domain 328..441 CDD:279382 18/120 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.