DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and jak2b

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_571162.1 Gene:jak2b / 30298 ZFINID:ZDB-GENE-980526-123 Length:1126 Species:Danio rerio


Alignment Length:293 Identity:100/293 - (34%)
Similarity:152/293 - (51%) Gaps:45/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   526 LMLMEELGSGQFGVVRRGKW------RGSIDTAVKMMKEGTMSE-DDFIEEAKVMTKLQHPNLVQ 583
            |:.:::||.|.||.|...::      .|.: .|||.::..|... .||..|.:::..|||.|:|:
Zfish   834 LIFLQQLGKGNFGSVEMCRYDPLQDNTGEV-VAVKKLQHSTTEHIRDFEREIEILKSLQHENIVK 897

  Fly   584 LYGVC--SKHRPIYIVTEYMKHGSLLNYLRR------HEKTLIGNMGLLLDMCIQVSKGMTYLER 640
            ..|||  :..|.:.:|.||:.:|||.:||.:      |:|        |:....|:.|||.||..
Zfish   898 YKGVCYGAGRRNLRLVMEYLPYGSLRDYLNKNRDRIDHQK--------LVHYASQICKGMEYLAT 954

  Fly   641 HNYIHRDLAARNCLVGSENVVKVADFGLARYVLDDQ--YTSSGGTKFPIKWAPPEVLNYTRFSSK 703
            ..|||||||.||.||.||..||:.||||.:.:..|:  |......:.||.|..||.|..::||..
Zfish   955 KRYIHRDLATRNILVESECRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWHAPESLTESKFSVA 1019

  Fly   704 SDVWAYGVLMWEIFT-----C----------GKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIY 753
            ||||::||:::|:||     |          |....|:.....::|.::||..|.:|..|..|::
Zfish  1020 SDVWSFGVVLYELFTYSDKLCSPPTVFLSMVGGDKQGQTIVYHLIELLKRGNRLPQPMGCPTEMF 1084

  Fly   754 DVMKLCWSHGPEERPAFRVLMDQLALVAQTLTD 786
            ::|:.||.:.|..||.|:    :|||....:.|
Zfish  1085 EIMQECWDNDPSLRPNFK----ELALRVDLIRD 1113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188
PTKc_Tec_like 521..778 CDD:173637 96/283 (34%)
Pkinase_Tyr 526..777 CDD:285015 96/282 (34%)
jak2bNP_571162.1 B41 29..262 CDD:214604
FERM_B-lobe 144..253 CDD:271216
FERM_C_JAK2 258..370 CDD:270141
SH2_Jak2 370..466 CDD:198242
PKc_like 528..791 CDD:304357
Pkinase_Tyr 528..790 CDD:285015
PKc_like 829..1112 CDD:304357 99/290 (34%)
TyrKc 834..1104 CDD:197581 96/282 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.