DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk and ZC581.7

DIOPT Version :10

Sequence 1:NP_476745.1 Gene:Btk / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_491913.1 Gene:ZC581.7 / 266838 WormBaseID:WBGene00022634 Length:395 Species:Caenorhabditis elegans


Alignment Length:40 Identity:11/40 - (27%)
Similarity:22/40 - (55%) Gaps:4/40 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EPLLSLPNTQSLIEPQTPTIPEIYFF---ILFFVDDFEAD 51
            |.:|.:..|...::|::.|.|...|:   ::.| :||.|:
 Worm   106 EDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVF-NDFSAE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtkNP_476745.1 PH_Btk 44..222 CDD:269944 4/8 (50%)
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188
PTKc_Tec_like 521..778 CDD:173637
ZC581.7NP_491913.1 SH2 9..97 CDD:472789
PK_Tyr_Ser-Thr 120..371 CDD:462242 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.