DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk and Fgfr2

DIOPT Version :10

Sequence 1:NP_476745.1 Gene:Btk / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_036844.1 Gene:Fgfr2 / 25022 RGDID:2611 Length:841 Species:Rattus norvegicus


Alignment Length:321 Identity:112/321 - (34%)
Similarity:170/321 - (52%) Gaps:44/321 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 SSPCDRPVPPTAGLSH------DKWEIHPMELMLMEELGSGQFGVV--------RRGKWRGSIDT 551
            ||..|.|:  .||:|.      .|||....:|.|.:.||.|.||.|        .:.:.:.::..
  Rat   472 SSTADTPM--LAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDRPKEAVTV 534

  Fly   552 AVKMMKEGTMSED--DFIEEAKVMTKL-QHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRH 613
            ||||:|:....:|  |.:.|.::|..: :|.|::.|.|.|::..|:|::.||...|:|..|||..
  Rat   535 AVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRAR 599

  Fly   614 EKTLIGNMGL------------------LLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENV 660
            ...     |:                  |:....|:::||.||.....|||||||||.||...||
  Rat   600 RPP-----GMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNV 659

  Fly   661 VKVADFGLARYVLD-DQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPY 724
            :|:|||||||.:.: |.|..:...:.|:||..||.|....::.:||||::|||||||||.|..||
  Rat   660 MKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPY 724

  Fly   725 GRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQLALVAQTLT 785
            ..:...|:.:.::.|..::||.:|..|:|.:|:.||...|.:||.|:.|::.|..:. |||
  Rat   725 PGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIL-TLT 784

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtkNP_476745.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188 2/3 (67%)
PTKc_Tec_like 521..778 CDD:173637 98/286 (34%)
Fgfr2NP_036844.1 Ig 50..143 CDD:472250
Ig strand B 77..81 CDD:409362
Ig strand C 88..92 CDD:409362
Ig strand E 109..113 CDD:409362
Ig strand F 123..128 CDD:409362
Ig strand G 136..139 CDD:409362
IgI_2_FGFR 173..267 CDD:409443
Ig strand A 173..176 CDD:409443
Ig strand A' 184..189 CDD:409443
Ig strand B 193..201 CDD:409443
Ig strand C 207..212 CDD:409443
Ig strand C' 215..217 CDD:409443
Ig strand D 226..229 CDD:409443
Ig strand E 233..238 CDD:409443
Ig strand F 247..254 CDD:409443
Ig strand G 257..267 CDD:409443
Ig 275..377 CDD:472250
Ig strand B 293..297 CDD:409353
Ig strand C 306..310 CDD:409353
Ig strand E 342..346 CDD:409353
Ig strand F 356..361 CDD:409353
Ig strand G 369..372 CDD:409353
PTKc_FGFR2 476..788 CDD:270679 110/317 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.