DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and FRK

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_002022.1 Gene:FRK / 2444 HGNCID:3955 Length:505 Species:Homo sapiens


Alignment Length:467 Identity:186/467 - (39%)
Similarity:272/467 - (58%) Gaps:32/467 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 PGGIPTPGTPNSKAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWW------KV 382
            ||.:.:|     :::.:.|:   .|||:.::|....|||.....:.:|:|...|.||      |.
Human    32 PGALCSP-----QSQRHGHY---FVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARHLEKR 88

  Fly   383 KDALGN--VGYIPSNYVKPKALLGLERYEWYVGDMSRQRAE-SLLKQGDKEGCFVVRKS-STKGL 443
            :|....  .||||||||.....|..|  .|:.|.:.|..|| .||...:|.|.|::|:| |.||.
Human    89 RDGSSQQLQGYIPSNYVAEDRSLQAE--PWFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGE 151

  Fly   444 YTLSLHTKVPQSHVKHYHIKQNARCEYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPCDR-P 507
            ::||:   :..:.||||.||:.....::|:.:....|:.:.::::...|.||..:| ..||.: .
Human   152 FSLSV---LDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKL-GKPCLKIQ 212

  Fly   508 VPPTAGLSH---DKWEIHPMELMLMEELGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEE 569
            ||....||:   |:|||....:.|::.|||||||.|..|.|..:...|||.:|.|:|..:||:.|
Human   213 VPAPFDLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLRE 277

  Fly   570 AKVMTKLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKG 634
            |::|..|:||.|:|||.||:...||||:||.|:||||..||:....:.| ::...:||..||:.|
Human   278 AQIMKNLRHPKLIQLYAVCTLEDPIYIITELMRHGSLQEYLQNDTGSKI-HLTQQVDMAAQVASG 341

  Fly   635 MTYLERHNYIHRDLAARNCLVGSENVVKVADFGLAR-YVLD--DQYTSSGGTKFPIKWAPPEVLN 696
            |.|||..|||||||||||.|||..|:.||||||||| :.:|  |.|.|....|.|:||..||.:.
Human   342 MAYLESRNYIHRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESRHEIKLPVKWTAPEAIR 406

  Fly   697 YTRFSSKSDVWAYGVLMWEIFTCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWS 761
            ..:||.|||||::|:|::||.|.|||||..:...:|::.:.:...|.:|.:|.::.|::|..||:
Human   407 SNKFSIKSDVWSFGILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWN 471

  Fly   762 HGPEERPAFRVL 773
            ..|:|||.|..|
Human   472 AEPKERPTFETL 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 22/60 (37%)
SH2_Tec_family 403..505 CDD:198188 32/103 (31%)
PTKc_Tec_like 521..778 CDD:173637 120/256 (47%)
Pkinase_Tyr 526..777 CDD:285015 119/251 (47%)
FRKNP_002022.1 SH3_Src_like 47..104 CDD:212779 19/56 (34%)
SH2_Src_Frk 112..207 CDD:199831 30/100 (30%)
PTKc_Frk_like 225..494 CDD:270653 123/260 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.