DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk and FGFR2

DIOPT Version :10

Sequence 1:NP_476745.1 Gene:Btk / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_075259.4 Gene:FGFR2 / 2263 HGNCID:3689 Length:822 Species:Homo sapiens


Alignment Length:321 Identity:113/321 - (35%)
Similarity:170/321 - (52%) Gaps:44/321 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 SSPCDRPVPPTAGLSH------DKWEIHPMELMLMEELGSGQFGVV--------RRGKWRGSIDT 551
            ||..|.|:  .||:|.      .|||....:|.|.:.||.|.||.|        .:.|.:.::..
Human   453 SSTADTPM--LAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTV 515

  Fly   552 AVKMMKEGTMSED--DFIEEAKVMTKL-QHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRH 613
            ||||:|:....:|  |.:.|.::|..: :|.|::.|.|.|::..|:|::.||...|:|..|||..
Human   516 AVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRAR 580

  Fly   614 EKTLIGNMGL------------------LLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENV 660
            ...     |:                  |:....|:::||.||.....|||||||||.||...||
Human   581 RPP-----GMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNV 640

  Fly   661 VKVADFGLARYVLD-DQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPY 724
            :|:|||||||.:.: |.|..:...:.|:||..||.|....::.:||||::|||||||||.|..||
Human   641 MKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPY 705

  Fly   725 GRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQLALVAQTLT 785
            ..:...|:.:.::.|..::||.:|..|:|.:|:.||...|.:||.|:.|::.|..:. |||
Human   706 PGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIL-TLT 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtkNP_476745.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188 2/3 (67%)
PTKc_Tec_like 521..778 CDD:173637 99/286 (35%)
FGFR2NP_075259.4 IgI_1_FGFR 31..124 CDD:409362
Ig strand A 31..34 CDD:409362
Ig strand A' 47..53 CDD:409362
Ig strand B 56..66 CDD:409362
Ig strand C 69..74 CDD:409362
Ig strand C' 77..79 CDD:409362
Ig strand D 84..88 CDD:409362
Ig strand E 91..96 CDD:409362
Ig strand F 102..111 CDD:409362
Ig strand G 114..124 CDD:409362
IgI_2_FGFR 154..248 CDD:409443
Ig strand A 154..157 CDD:409443
Ig strand A' 165..170 CDD:409443
Ig strand B 174..182 CDD:409443
Ig strand C 188..193 CDD:409443
Ig strand C' 196..198 CDD:409443
Ig strand D 207..210 CDD:409443
Ig strand E 214..219 CDD:409443
Ig strand F 228..235 CDD:409443
Ig strand G 238..248 CDD:409443
Ig 256..358 CDD:472250
Ig strand B 274..278 CDD:409353
Ig strand C 287..291 CDD:409353
Ig strand E 323..327 CDD:409353
Ig strand F 337..342 CDD:409353
Ig strand G 350..353 CDD:409353
PTKc_FGFR2 457..769 CDD:270679 111/317 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.