DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and Srms

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_035611.3 Gene:Srms / 20811 MGIID:101865 Length:507 Species:Mus musculus


Alignment Length:465 Identity:167/465 - (35%)
Similarity:244/465 - (52%) Gaps:26/465 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 PGGIPTPGTPNSKAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVK-DALG 387
            |...|.|.            .:|..|||.|.|....:||:.:......:.:..::.:..: ....
Mouse    60 PCSFPAPR------------ARLFRALYDFTARCAEELSVSRGDRLYALKEEGDYIFAQRLSGPP 112

  Fly   388 NVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAES-LLKQGDKEGCFVVRKS-STKGLYTLSLHT 450
            :.|.:|..|:............||...:||.:|:. ||...:..|.|::|.| |:.|.|:||:..
Mouse   113 STGLVPVTYLAKATPEPPSDQPWYFSGISRAQAQQLLLSPANAPGAFLIRPSESSIGGYSLSVRA 177

  Fly   451 KVPQSHVKHYHIKQNARCEYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPCDRPVPPTAGLS 515
               |:.|.||.|........||.|.....::..|:.|::.|     .:|..:|..:|..|...|.
Mouse   178 ---QAKVCHYRICMAPSGSLYLQEGQLFPSLDALLAYYKTN-----WKLIQNPLLQPCIPQIPLV 234

  Fly   516 HDKWEIHPMELMLMEELGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPN 580
            .|:||....|.:|..:||.|.||.|..|.|.|||..|||::|...|...|..:|.:.:..|:|..
Mouse   235 QDEWERPRSEFVLRRKLGEGFFGEVWEGLWLGSIPVAVKVIKSADMKLADLTKEIEALKSLRHER 299

  Fly   581 LVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHE-KTLIGNMGLLLDMCIQVSKGMTYLERHNYI 644
            |::|:.:||...|:|||||.|..|:|..||...| |.|  ::..||....||::||:|||....:
Mouse   300 LIRLHAICSLGEPVYIVTELMGKGNLQVYLGSSEGKAL--SLPHLLGFACQVAEGMSYLEERRVV 362

  Fly   645 HRDLAARNCLVGSENVVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAY 709
            ||||||||.|||.:...|||||||||.:.||.|:.|.|:|.|:||..||..||..||.|||||::
Mouse   363 HRDLAARNVLVGDDLTCKVADFGLARLLKDDVYSPSSGSKIPVKWTAPEAANYRVFSQKSDVWSF 427

  Fly   710 GVLMWEIFTCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLM 774
            |:|::|:||.|:.||..:.|.|.::::.||..|.:|..|..|:|.:|..||...|||||.|.:|.
Mouse   428 GILLYEVFTYGQCPYEGMTNHETLQQISRGYRLPRPAVCPAEVYVLMVECWKGSPEERPTFAILR 492

  Fly   775 DQLALVAQTL 784
            ::|..:.:.|
Mouse   493 EKLNAINRRL 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 11/53 (21%)
SH2_Tec_family 403..505 CDD:198188 29/103 (28%)
PTKc_Tec_like 521..778 CDD:173637 116/257 (45%)
Pkinase_Tyr 526..777 CDD:285015 115/251 (46%)
SrmsNP_035611.3 SH3 70..124 CDD:302595 11/53 (21%)
SH2_Srm 134..212 CDD:198223 25/80 (31%)
PTKc_Srm_Brk 238..498 CDD:133248 119/261 (46%)
STYKc 246..495 CDD:214568 115/250 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.