DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk29A and Ptk6

DIOPT Version :9

Sequence 1:NP_001097121.1 Gene:Btk29A / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_033210.1 Gene:Ptk6 / 20459 MGIID:99683 Length:451 Species:Mus musculus


Alignment Length:451 Identity:166/451 - (36%)
Similarity:238/451 - (52%) Gaps:26/451 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 DNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWW-KVKDALGNV---GYIPSNYVKP 399
            |.:|.....|.|:.|||....:||.:......|....:..|| .:.||.|..   ||:|.||:..
Mouse     5 DKAHLGPKYVGLWDFKARTDEELSFQAGDLLHVTKKEELWWWATLLDAEGKALAEGYVPHNYLAE 69

  Fly   400 KALLGLERYEWYVGDMSRQRAESLLKQGD-KEGCFVVRKSSTKGL-YTLSLHTKVPQSHVKHYHI 462
            |..  :|...|:.|.:||..|...|:..| .:|.|::|.|...|. |.||:.   ....|:||.|
Mouse    70 KET--VESEPWFFGCISRSEAMHRLQAEDNSKGAFLIRVSQKPGADYVLSVR---DAQAVRHYRI 129

  Fly   463 KQNARCEYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPC----DRPVPPTAGLSH-DKWEIH 522
            .:|.....:|:|......:.:|::||:..|.....:| |.||    ..|:|      | |.||..
Mouse   130 WKNNEGRLHLNEAVSFSNLSELVDYHKTQSLSHGLQL-SMPCWKHKTEPLP------HWDDWERP 187

  Fly   523 PMELMLMEELGSGQFGVVRRGKWRGSIDTAVKMM-KEGTMSEDDFIEEAKVMTKLQHPNLVQLYG 586
            ..|..|.::||:|.||.|....|:|.:..|||:: ::..:.:..|..|.:.|.||:|.:::.||.
Mouse   188 REEFTLCKKLGAGYFGEVFEALWKGQVHVAVKVISRDNLLHQHTFQAEIQAMKKLRHKHILSLYA 252

  Fly   587 VCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAAR 651
            |.:...|:||:||.|..|:||..||..::..:..:. |:|...||::||.|||..||||||||||
Mouse   253 VATAGDPVYIITELMPKGNLLQLLRDSDEKALPILE-LVDFASQVAEGMCYLESQNYIHRDLAAR 316

  Fly   652 NCLVGSENVVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEI 716
            |.||...|:.||.||||||.|.:|.|.|. ....|.||..||.|:...:|.|||||::|||:.||
Mouse   317 NVLVTENNLCKVGDFGLARLVKEDIYLSH-EHNVPYKWTAPEALSRGHYSIKSDVWSFGVLLHEI 380

  Fly   717 FTCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQL 777
            |:.|:|||..:.|.|...||..|..:..|..|...|:.:|..|||..|::||.|:.|.::|
Mouse   381 FSRGQMPYPGMSNHETFLRVDAGYRMPCPLECPPNIHKLMLSCWSRDPKQRPCFKDLCEKL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Btk29ANP_001097121.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702 18/56 (32%)
SH2_Tec_family 403..505 CDD:198188 31/107 (29%)
PTKc_Tec_like 521..778 CDD:173637 108/258 (42%)
Pkinase_Tyr 526..777 CDD:285015 106/251 (42%)
Ptk6NP_033210.1 SH3 12..69 CDD:302595 18/56 (32%)
SH2_PTK6_Brk 75..174 CDD:198221 30/102 (29%)
Linker 171..190 6/24 (25%)
PKc_like 184..444 CDD:304357 110/260 (42%)
STYKc 192..441 CDD:214568 106/250 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.