DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk and Y43C5B.2

DIOPT Version :10

Sequence 1:NP_476745.1 Gene:Btk / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_501907.1 Gene:Y43C5B.2 / 189849 WormBaseID:WBGene00012785 Length:245 Species:Caenorhabditis elegans


Alignment Length:243 Identity:63/243 - (25%)
Similarity:107/243 - (44%) Gaps:50/243 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 LERYEWYVGDMSRQRAESLLKQGDKEGCFVVRKS-----STKGLYTLSLHTKVP-QSHVKHYHIK 463
            :|:..:|.|.:.|:..:::||   ..|.||:|.|     |.:......:|...| :..:|||.||
 Worm    13 IEKEPYYHGFLPREDVKTVLK---NNGDFVIRISEPQAGSPRSNILSVMHCVPPMEEEIKHYVIK 74

  Fly   464 QNARCEYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPCDRPVPPTAGLSHDKWEIHPMELML 528
              .:.:....||....:||:::.:|         ..|.....:.|.....:|...||:....:..
 Worm    75 --TKGDKIFIEKVSFLSIPEMVEWH---------LTKKESVQKDVFLIKAISRQAWELDHDNIEP 128

  Fly   529 MEELGSGQFGVVRRG--KWR---GSIDTAVKMMKEGTMSED---DFIEEAKVMTKLQHPNLVQLY 585
            :::||.|.||.|..|  |:|   .|:..|:|..|...::::   :|:.||:||..|.||::|:.|
 Worm   129 LKKLGEGAFGEVMMGTMKFRKGGKSVQVAIKQAKLSNLTKEQIKEFMGEARVMRSLSHPHVVRFY 193

  Fly   586 GV---------CSK--------HRPIYIVTEY-----MKHGSLLNYLR 611
            ||         |..        ||.:...|.:     :...|:||.||
 Worm   194 GVPRRRVNVALCRSLNEFLAKCHRKLRCATPFFVCMSVNWLSVLNELR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtkNP_476745.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188 25/105 (24%)
PTKc_Tec_like 521..778 CDD:173637 34/121 (28%)
Y43C5B.2NP_501907.1 SH2_Fps_family 11..104 CDD:198224 25/104 (24%)
Protein Kinases, catalytic domain 129..>218 CDD:473864 27/88 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.